SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09945
Pre Gene Modal
BGIBMGA013240
Annotation
PREDICTED:_LOW_QUALITY_PROTEIN:_cytochrome_P450_3A19-like_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.658 PlasmaMembrane   Reliability : 1.845
 

Sequence

CDS
ATGGACTGCATAGGCGGTTGTGTGTTCGGAGTAGACATTAATGCGATGCAGGAACCCAAGGATAACATCTTCACAACTATGGGATGCCTTTTCTTGGAGACCACCACCTCCCGAGGTATAAAAAACGTTGTCAAAGCTATCTGGCCGGAAATATTCTATGGACTAGGTTTCAAAGTATTTCCAACGGATATACATAAGTTTTTCAGTAAACTTCTAGTAAGAATTTTCGAAGCACGGGACTACAAGCCTTCCGAACGTACCGATTTCGTCGACCTGTTGTTAAATTTGAAGAAGAACAGACATATCGTCGGCGACCGCTTGCAAAAGATTAAAACAGGAGACGAAGGAGCAGACAGTAAATTAGAACTAGAAGTGAATGATGATCTGTTAGTTGCACAATGCGTTTCATTCTTTATCGCTGGTTTTGAAACTTCATCCAATTCTTTAACCTTTACTTTGTACGAGCTGGCAAAGAATCCAGATGTTCAGAAAAGAGCGCAGAAAGAAGTAGACGAATATATTAAGAAGCACAACAATAAACTAGATTATGATTGCGTGAAGGAACTCCCGTTTGTGGAGGCGTGTATAGATGAAGCGCTACGTTTGTATCCTCTTTTTGGGGTAATATCAAGACAAACGGGAACGATACACATTCCCGACCGGCCTGACTCTCGACAAAGGAGATCGCGTTCATATTCCTGTGTATCATCTGCATCACGACCCGGAATACTTTCCGGAGCCCGAGCTCTTCAAACCAGAGAGGTTCTATGGGGAAGAGAAGAAGAATATCAGGCCCTTTACGTATTTGCCATTTGGAGCTGGACCTCGGGTTTGTATTGGTGA
Protein
MDCIGGCVFGVDINAMQEPKDNIFTTMGCLFLETTTSRGIKNVVKAIWPEIFYGLGFKVFPTDIHKFFSKLLVRIFEARDYKPSERTDFVDLLLNLKKNRHIVGDRLQKIKTGDEGADSKLELEVNDDLLVAQCVSFFIAGFETSSNSLTFTLYELAKNPDVQKRAQKEVDEYIKKHNNKLDYDCVKELPFVEACIDEALRLYPLFGVISRQTGTIHIPDRPDSRQRRSRSYSCVSSASRPGILSGARALQTREVLWGREEEYQALYVFAIWSWTSGLYW

Summary

Similarity
Belongs to the cytochrome P450 family.
EMBL
BABH01022704    BABH01022698    BABH01022694    BABH01022705    EF432656    ABO21682.1    + More
GU731531    ADE05581.1    KX443435    ASO98010.1    ODYU01000083    SOQ34238.1    JTDY01000942    KOB75351.1    ODYU01000082    SOQ34237.1    GCVX01000058    JAI18172.1    NWSH01003425    PCG66326.1    DQ256407    ABB69054.1    KM016736    AID54888.1    JTDY01000878    KOB75583.1    KM016740    AID54892.1    JX310082    AFP20593.1    KOB75582.1    JTDY01005369    KOB67074.1    KJ671575    AID55427.1    NWSH01002736    PCG67604.1    KU145393    ANC96676.1    NWSH01002369    PCG68452.1    KF853191    AHH92929.1    PCG66327.1    JTDY01009617    KOB63214.1    PCG68453.1    EU807990    ACF17813.2    JN375491    AEY75585.1    JN375489    AEY75583.1    KM016735    AID54887.1    MH138190    AXP17131.1    KM016738    AID54890.1    JTDY01000272    KOB77971.1    KM016741    AID54893.1    KX443432    ASO98007.1    FN356971    CAX94849.1    KJ671576    AID55428.1    PCG67605.1    KM016744    AID54896.1    KP001126    AJN91171.1    DQ986461    JN176574    ABI84381.1    AET11931.1    KM016737    AID54889.1    GU937509    ADW23116.1    SOQ34236.1    KY212045    ARA91609.1    KR095600    AKS48888.1    AK343205    BAM73891.1    GDQN01005882    JAT85172.1    AK289291    AK343204    BAM73818.1    BAM73890.1    FJ387169    ACJ10074.1    GQ241737    ADD70250.1    BABH01015309    KY212043    ARA91607.1    KM016739    AID54891.1    ODYU01008863    SOQ52829.1    RSAL01000158    RVE45548.1    KF701137    AHW57307.1    KM016742    AID54894.1    KJ645906    AIJ00763.1    RVE45546.1    RVE45549.1    EF528485    ABP99019.1    GQ915322    ACZ97416.2    EF415296    ABN71367.1    AK289290    BAM73817.1    RVE45547.1    KX443430    ASO98005.1    EU309477    ABY40426.1    EU273875    ABX64438.1    PCG68451.1    GCVX01000049    JAI18181.1    AY295774    AAP83689.1    EF547545    ABQ42339.1    EF528486    ABP99020.1    EF432657    ABO21683.1    KQ460655    KPJ12961.1    JX310077    AFP20588.1    KY212044    ARA91608.1    KQ459388    KPJ01135.1    JX310078    AFP20589.1    ODYU01004193    SOQ43795.1    AGBW02008320    OWR53726.1    AK343206    BAM73892.1    EF535809    ABQ08711.1    MH236461    QBA57466.1    MH151918    QAX33066.1    EU273877    ABX64440.1    KJ645907    AIJ00764.1    ODYU01004424    SOQ44278.1    MH138218    AXP17159.1    KX443431    ASO98006.1    GCVX01000081    JAI18149.1    GCVX01000069    JAI18161.1    OWR53729.1    SOQ43796.1    OWR53725.1    ODYU01004192    SOQ43793.1    FN544262    CBB07053.1   
Pfam
PF00067   p450        + More
PF09453   HIRA_B
Interpro
IPR036396   Cyt_P450_sf        + More
IPR002401   Cyt_P450_E_grp-I       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR002402   Cyt_P450_E_grp-II       
IPR019015   HIRA_B_motif       
SUPFAM
SSF48264   SSF48264       
Gene 3D
PDB
6MJM     E-value=7.05611e-21,     Score=246

Ontologies

Topology

Length:
280
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.06634
Exp number, first 60 AAs:
0.03448
Total prob of N-in:
0.01396
outside
1  -  280
 
 

Population Genetic Test Statistics

Pi
341.386872
Theta
209.280733
Tajima's D
1.972562
CLR
0
CSRT
0.87885605719714
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号