SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09887
Pre Gene Modal
BGIBMGA013162
Annotation
PREDICTED:_uncharacterized_protein_LOC105388832_[Plutella_xylostella]
Location in the cell
Mitochondrial   Reliability : 1.514 Nuclear   Reliability : 1.885
 

Sequence

CDS
ATGACTAAGTTCAGTGGCGAAGATCACACTTACACCTCAACGAAATGGGCGCAGGATCTAGAAGACAACGCCGAAATATTTGGATGGTCGCCTCAACAACTACTTATCATAGCACGTAGATCTTTATCAGGAACAGCACAGTTATGGTTAAAGACGGAGAAGGTTCATAAAAGTTATGAAGAACTCAAGGCAGCCCTGCTCAAAGAATTTCCTGACGTGATGAACAGCAAAGAGATGCATGAGCTCATGACTGCGCGCAAGAAACATAAAGACGAGTCATATTATCAATATATGCTAATTATGAAGGAAATGGGAAAACGAGCGAGATTCCCAGATTACGTTGCCATTCAGTACATCATAGACGGCATTACAGACCTGGAGATGAATAAAGCAATTTTGTACGGTGCGGTTACTTATCCGGTGCTGAAAGAAAAGTTGTTGTTGTACGAAAGGATCAAGGAGAAATCTGCCAAACAGAATGCTGAACTACATATTAAACGAACTGCAACGACTTCGGTTAGAGATTCCATGTCAAGAACCAACCAGTATTGTGCAATAAATTTGGCCATATTAGTTCAAAGTGCATCAATTCTAACACAGGAAGTACCGAAAGTTCGAGTTACACGAAAACGTCGGTAA
Protein
MTKFSGEDHTYTSTKWAQDLEDNAEIFGWSPQQLLIIARRSLSGTAQLWLKTEKVHKSYEELKAALLKEFPDVMNSKEMHELMTARKKHKDESYYQYMLIMKEMGKRARFPDYVAIQYIIDGITDLEMNKAILYGAVTYPVLKEKLLLYERIKEKSAKQNAELHIKRTATTSVRDSMSRTNQYCAINLAILVQSASILTQEVPKVRVTRKRR

Summary

EMBL
NWSH01002403    PCG68369.1    NWSH01001586    PCG70783.1    NWSH01001874    PCG69832.1    + More
NWSH01000799    PCG74125.1    NWSH01004261    PCG65293.1    NWSH01000198    PCG78490.1    NWSH01000337    PCG77293.1    ODYU01001505    SOQ37806.1    NWSH01002797    PCG67520.1    NWSH01002225    PCG68884.1    RSAL01000438    RVE41711.1    ACPB03028153    GBBI01004550    JAC14162.1    GBBI01004551    JAC14161.1    CH478509    EJY58114.1    GBXI01005773    JAD08519.1    GAMC01016174    JAB90381.1    GBBI01004613    JAC14099.1    QOIP01000004    RLU23736.1    LBMM01009423    KMQ88147.1    KQ971327    KYB28419.1    KQ415113    KOC58816.1    GDHF01031998    JAI20316.1    LBMM01010976    KMQ87102.1    GBXI01006173    JAD08119.1    ABLF02014660    ABLF02042774    GBBI01004477    JAC14235.1    KQ971355    KYB26210.1    KQ972211    EFA11958.2    GAKP01001187    JAC57765.1    GEHC01000930    JAV46715.1    ABLF02005127    ABLF02005129    ABLF02007401    GBXI01004632    JAD09660.1    GAKP01000546    JAC58406.1    GDHF01031400    JAI20914.1    GAMC01015907    JAB90648.1    AGBW02003316    OWR55561.1    KQ971376    KYB25116.1    GAMC01020207    JAB86348.1    GAMC01002792    JAC03764.1    GBHO01014721    JAG28883.1    GGFM01002109    MBW22860.1    AAAB01008984    HACL01000135    CFW94429.1    ATLV01014583    KE524975    KFB39094.1    GAMC01007326    JAB99229.1    ACPB03027146    ABLF02011059    AJWK01016333    GGFM01002486    MBW23237.1   
Pfam
PF00098   zf-CCHC        + More
PF00077   RVP
PF00078   RVT_1
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF16064   DUF4806
PF17917   RT_RNaseH
PF02037   SAP
PF00067   p450
PF03732   Retrotrans_gag
PF14392   zf-CCHC_4
PF09668   Asp_protease
PF12017   Tnp_P_element
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR000477   RT_dom       
IPR018061   Retropepsins       
IPR041577   RT_RNaseH_2       
IPR001584   Integrase_cat-core       
IPR012337   RNaseH-like_sf       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR032071   DUF4806       
IPR041373   RT_RNaseH       
IPR003034   SAP_dom       
IPR002401   Cyt_P450_E_grp-I       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR036396   Cyt_P450_sf       
IPR036361   SAP_dom_sf       
IPR005162   Retrotrans_gag_dom       
IPR025836   Zn_knuckle_CX2CX4HX4C       
IPR019103   Peptidase_aspartic_DDI1-type       
IPR021896   Transposase_37       
SUPFAM
SSF50630   SSF50630        + More
SSF57756   SSF57756       
SSF53098   SSF53098       
SSF68906   SSF68906       
SSF48264   SSF48264       

Ontologies

Topology

Length:
212
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.25982
Exp number, first 60 AAs:
0.00134
Total prob of N-in:
0.32635
outside
1  -  212
 
 

Population Genetic Test Statistics

Pi
335.196001
Theta
181.50217
Tajima's D
2.51194
CLR
0.006301
CSRT
0.945152742362882
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号