SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09849
Pre Gene Modal
BGIBMGA013280
Annotation
PREDICTED:_fatty_acid_synthase-like_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 1.148
 

Sequence

CDS
ATGAAAATTTTAATACACGAAGGAGCTGGAGCACTCGGCCAGGCTGCCATAGCCATTGCTCTGGCACACAAATGTCAAGTGTTCACTACAGTTGGGGACGTGAGAACTAAAAGTTTCTTGGAAAAGCTCTATCCAGAATTGAAAGAACAACACATTGGGAATTCTCGAGATATGACTTTTGGTGACATGGTACTATCAGCAACAAATGGGAAAGGTTGCGATGTTGTAATATGCAATGTCGAACCCTGGCTCAAACATGTTTCACTTCAATGTGGTGGTGCTTTAAGCATTATAATTGACACGGCACAAATATACAACCAGGAGAAGTTCGAATTTCGTATGAATAGTCTGATCAATGATAGATCCTATGTAATTGCCGATTTCTCGTCCATCTTCGATTTTGCGAAAAATGAAGAATTTAAAAAATTACAAATCCTCGTGAGTGGGGGCATCTCCAAGGGCTACGTGCGACCACTAGGGCGAGTGACCTATGCTGCAGATGAAGCTCCACGAGCTCTACGCCTATTATCGAAGGGTTGGCATCGAGGACATGTGCTTTTAAGACTTACAGATCGAGCGCTTCCAGCTAGCCCTAGGATCAACTATACTTCTGAATGCAGCCATTTAATCATCTGCAGCGACGAATATTTTGGTATTCAGTTGGCACAAAGGCTTATCAGTAGAGGAGCCAGAATGCTACATATCTGTTGTTCGAAGCTTTCATGGTATCTCCAACATCAAACTGAAAATCTTAAATCTCTTGGAGTGAATGTTATCGTATCTTCAAATAACTTAAAAGATTTGGATGATGTTGCGACCGTCCTAAAGAAAACTATAGCCATGGGTCCGGTAGAAGGCGTATATGTGACGAGCTTCAAAGATATGGATAAATATACATCAAATAGCTTGGAATACCTTGATGCTATGTCACGAAAATTTTGCCCATTCCTGAAGTGA
Protein
MKILIHEGAGALGQAAIAIALAHKCQVFTTVGDVRTKSFLEKLYPELKEQHIGNSRDMTFGDMVLSATNGKGCDVVICNVEPWLKHVSLQCGGALSIIIDTAQIYNQEKFEFRMNSLINDRSYVIADFSSIFDFAKNEEFKKLQILVSGGISKGYVRPLGRVTYAADEAPRALRLLSKGWHRGHVLLRLTDRALPASPRINYTSECSHLIICSDEYFGIQLAQRLISRGARMLHICCSKLSWYLQHQTENLKSLGVNVIVSSNNLKDLDDVATVLKKTIAMGPVEGVYVTSFKDMDKYTSNSLEYLDAMSRKFCPFLK

Summary

EMBL
ODYU01001484    SOQ37744.1    NWSH01000156    PCG78966.1    GEYN01000115    JAV02014.1    + More
ODYU01003708    SOQ42815.1    KQ461178    KPJ07769.1    PCG78967.1    KQ459602    KPI93194.1    PCG78965.1    RSAL01000013    RVE53445.1    RSAL01000223    RVE44002.1    RSAL01000008    RVE53970.1    PCG78963.1    AGBW02013713    OWR42929.1    JTDY01002311    KOB71689.1    RVE53971.1    JTDY01003263    KOB69848.1    JTDY01003650    KOB69211.1    JTDY01006902    KOB65606.1    GEYN01000117    JAV02012.1    RVE53441.1    U67866    AAB53257.1    RSAL01000068    RVE49259.1    NWSH01005646    PCG64083.1    ODYU01001294    SOQ37311.1    NWSH01000591    PCG75472.1    RVE44006.1    PCG75471.1    ODYU01012325    SOQ58579.1    GEDC01024813    JAS12485.1    KQ459582    KPI99075.1    KQ971344    EFA05201.1    NWSH01003873    PCG65733.1    PCG65731.1    KZ150116    PZC73265.1    ODYU01006431    SOQ48269.1    MF817713    AXE71619.1    KK852680    KDR18643.1    BABH01033637    KY797274    ATL76713.1    NNAY01001038    OXU25389.1    LIAE01010181    PAV65933.1    GBBM01000423    JAC34995.1    KQ435007    KZC13477.1    KZ288370    PBC26760.1    ODYU01002245    SOQ39471.1    HE600913    CAP31392.2    CVRI01000038    CRK94451.1    AGBW02007651    OWR55047.1    UZAG01001243    VDO10800.1    KQ460651    KPJ13003.1    GL445739    EFN89136.1    ODYU01009273    SOQ53573.1    EFA05204.2    UFQT01000602    SSX25625.1    PDUG01000001    PIC51785.1    ODYU01011246    SOQ56864.1    GL448189    EFN85168.1    KQ435885    KOX69550.1    NNAY01001760    OXU23005.1    KQ461073    KPJ09498.1    MH297661    QBA29753.1    GALX01004174    JAB64292.1    LN856968    CDP97001.1    EFA05248.1    ADBV01000924    EJW85964.1    UZAD01000374    VDN83662.1    EFA05203.2    U67867    AAB53258.1    BABH01003987    BABH01003988    CM004482    OCT62677.1    KK118976    KFM74313.1    UFQS01001117    UFQT01001117    SSX09070.1    SSX28981.1    CM012455    RVE59889.1    GBYB01001821    JAG71588.1    FR905440    CDQ79329.1    GBYB01001820    JAG71587.1    GECU01021338    JAS86368.1    GECU01006695    JAT01012.1    KX147671    ARI45075.1    CVRI01000051    CRK99510.1    OXU23004.1    UFQT01002952    SSX34336.1    GEBQ01031053    JAT08924.1    NEVH01022635    PNF18738.1    BX284601    CAB04244.2    SSX34335.1   
Pfam
PF00698   Acyl_transf_1        + More
PF14765   PS-DH
PF02801   Ketoacyl-synt_C
PF08659   KR
PF00109   ketoacyl-synt
PF16197   KAsynt_C_assoc
PF00107   ADH_zinc_N
PF00975   Thioesterase
PF00550   PP-binding
Interpro
IPR020801   PKS_acyl_transferase        + More
IPR020843   PKS_ER       
IPR029058   AB_hydrolase       
IPR001227   Ac_transferase_dom_sf       
IPR020807   PKS_dehydratase       
IPR016035   Acyl_Trfase/lysoPLipase       
IPR016036   Malonyl_transacylase_ACP-bd       
IPR014043   Acyl_transferase       
IPR036291   NAD(P)-bd_dom_sf       
IPR011032   GroES-like_sf       
IPR042104   PKS_dehydratase_sf       
IPR020841   PKS_Beta-ketoAc_synthase_dom       
IPR016039   Thiolase-like       
IPR014030   Ketoacyl_synth_N       
IPR013968   PKS_KR       
IPR032821   KAsynt_C_assoc       
IPR023102   Fatty_acid_synthase_dom_2       
IPR014031   Ketoacyl_synth_C       
IPR013149   ADH_C       
IPR001031   Thioesterase       
IPR036736   ACP-like_sf       
IPR018201   Ketoacyl_synth_AS       
IPR009081   PP-bd_ACP       
IPR020806   PKS_PP-bd       
IPR029063   SAM-dependent_MTases       
IPR006162   Ppantetheine_attach_site       
SUPFAM
SSF52151   SSF52151        + More
SSF51735   SSF51735       
SSF50129   SSF50129       
SSF55048   SSF55048       
SSF53474   SSF53474       
SSF53901   SSF53901       
SSF47336   SSF47336       
SSF53335   SSF53335       
PDB
2VZ9     E-value=3.98075e-21,     Score=249

Ontologies

Topology

Length:
318
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.16679
Exp number, first 60 AAs:
0.1598
Total prob of N-in:
0.01547
outside
1  -  318
 
 

Population Genetic Test Statistics

Pi
155.213756
Theta
160.550555
Tajima's D
0.307855
CLR
165.634065
CSRT
0.462576871156442
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号