SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09578  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA013006
Annotation
Glucose_dehydrogenase_[acceptor]_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 1.388
 

Sequence

CDS
ATGATAAATAAACGGTGCTATTGGCCGAGAGGCAGGGCGATCGGAGGTACCAGCGTTATCAACTACATGATATACACGAGGGGACGGCCCGAGGAGTGGGACAGGATCGAAGCTGCAGGAAACTATGGATGGTCGTACAAAGACGTTTTGCCTTATTATATGAAATCAGAAAGAGCCCAATTGGACGGCTTGGAGAACACCCCATACAGAAGCAAGGATGGCGAAATGAACGTAGAATTTGTGAAGTTCAGAACGCCACTCATAAACGCATTTTTAGAAGCTGGGAGAATACTGGGTCATCCAACTATAGACTACAACAGCCCAGAAGAACTCGGATTCGGATATGTCCAAACAACCACACTAACGGGAAGAAGAGTTAGCTCAGCGAAAGCATTTCTTCACCCAAACAAAAAGCGAAATAATCTCCACGTCATGCCGATGACGACTGCAACCAAAGTTTTAATAGACGAAGCCGCAACTGCCTATGGAGTCGAATACGTACGTAATCGTCTCAAATCACGGGTCAAAGCGAGACGAGAGATAATTCTGAGCGCTGGTCCAATAGCTTCACCTCAACTATTAATGCTTTCCGGAATAGGCCCGAAGGATCAACTCCGCCGTAATGGAATCCCTCTTATTGCTGACCTTCAAGTAGGTCAAACCCTTTACGATCACATTACGTTTCCCGGTTTAATATTTAAGCTCAACGTCACGAACGTGAGTGTCAATGAAAACAGGGACGCAACTCTTAAGAATGTATTGGAGTGGATCCAATATGGCGACAATGTAGTCGCATCGCCGGGTGGCGTTGAGGGTATTGGTTACATCAAAACTCCTGTTTCCGATACCCCTCTGCCGATCCCGGATATCGAATTAATTAGTATCGGAGGATCTTTGGTTTCCGACGGTGGCTCGACCGGAAGCAAAGCAGTTCGAAGAGGAATGAGAATTAGGGATCACGTCTTTAATAAAGCTTACGGGTCTATAGATAGCACGGATACGTGGAGTGCATTCCCGATGCTGCTACATCCAAAATCCGTCGGATATTTAGAACTCAAAGACAGTAATCCGTTTAGCCATCCAAGGATGTACGGGAATTATTTAACGGACCCAAAAGACGTTGCCACCTTTGTTGCCTCGATACGACACATCCAAGCTTTGGCTGCAACTCCGCCGTTCCAAAAATTTGGAGCTAAACTACATAGAGCAGAATATCCAGACTGTAAAGATTTACAGTTTGATTCCGATGAATATTGGGAATGCGCTGTACGGACACTGACGGCTACCTTACATCATCAGATCGCTACGTGTCGGATGGGCCCTGAAGAGGATCCTATGGCCGTAGTGGATCCAGAACTCCGAGTTTATGGCGTCAAAAATCTACGTGTTGTAGATTCTAGTGTTATACCTAATACTGTTTCCGTTCACACCCACGCGCCAGCTGTTATGATAGGAGAAAAAGCTGCGGACATGATCAAAGCAAGTTGGAGGTAG
Protein
MINKRCYWPRGRAIGGTSVINYMIYTRGRPEEWDRIEAAGNYGWSYKDVLPYYMKSERAQLDGLENTPYRSKDGEMNVEFVKFRTPLINAFLEAGRILGHPTIDYNSPEELGFGYVQTTTLTGRRVSSAKAFLHPNKKRNNLHVMPMTTATKVLIDEAATAYGVEYVRNRLKSRVKARREIILSAGPIASPQLLMLSGIGPKDQLRRNGIPLIADLQVGQTLYDHITFPGLIFKLNVTNVSVNENRDATLKNVLEWIQYGDNVVASPGGVEGIGYIKTPVSDTPLPIPDIELISIGGSLVSDGGSTGSKAVRRGMRIRDHVFNKAYGSIDSTDTWSAFPMLLHPKSVGYLELKDSNPFSHPRMYGNYLTDPKDVATFVASIRHIQALAATPPFQKFGAKLHRAEYPDCKDLQFDSDEYWECAVRTLTATLHHQIATCRMGPEEDPMAVVDPELRVYGVKNLRVVDSSVIPNTVSVHTHAPAVMIGEKAADMIKASWR

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
EMBL
BABH01003829    BABH01003830    RSAL01000051    RVE50270.1    ODYU01006526    SOQ48459.1    + More
NWSH01001458    PCG71170.1    KQ460323    KPJ15970.1    RVE50271.1    KQ458756    KPJ05260.1    BABH01003831    JTDY01001201    KOB74558.1    AGBW02007651    OWR55011.1    RSAL01000001    RVE55122.1    KZ149911    PZC78108.1    AGBW02014789    OWR41062.1    JTDY01004843    KOB67682.1    ODYU01002091    SOQ39165.1    KPJ05259.1    KPJ15971.1    OWR55012.1    KQ460883    KPJ11152.1    AK402758    BAM19368.1    KQ459603    KPI92808.1    BABH01003834    JTDY01000138    KOB78646.1    ODYU01000745    SOQ35996.1    AJVK01032026    KQ435703    KOX80330.1    CVRI01000064    CRL05333.1    KZ288238    PBC31353.1    GL436992    EFN71295.1    UFQS01000369    UFQT01000369    SSX03246.1    SSX23612.1    SSX03245.1    SSX23611.1    GL763984    EFZ18940.1    DS235784    EEB16960.1    KQ759784    OAD62863.1    KQ971348    KYB26873.1    EFA05534.2    GL448571    EFN84154.1    GAPU01000071    JAB84774.1    KPJ15961.1    CH477290    EAT44646.1    KK853018    KDR12457.1    ADTU01026680    KQ976532    KYM81568.1    DS235131    EEB12342.1    AAZX01003729    KQ414579    KOC71135.1    DS231832    EDS31770.1    KK107261    EZA53935.1    NEVH01013984    PNF27957.1    CH963851    EDW75334.1    QOIP01000012    RLU15835.1    AXCM01005241    HQ857156    AEM60158.1    JXUM01027342    JXUM01027343    KQ560787    KXJ80884.1    GBXI01003797    JAD10495.1    JXUM01024565    KQ560694    KXJ81242.1    GL888284    EGI63343.1    KXJ81243.1    KXJ80883.1    CH954180    EDV47079.1    KQ459595    KPI96020.1    GAKP01003902    JAC55050.1    KQ434869    KZC09314.1    KZC09328.1    HQ245150    AEB91339.1    HQ245146    AEB91347.1    KQ982937    KYQ49100.1    EDS31769.1    GEDC01013151    JAS24147.1    GL888048    EGI68822.1    UFQS01002238    UFQT01002238    SSX13567.1    SSX32994.1    LBMM01006334    KMQ90686.1    GDHF01030739    JAI21575.1    CH477801    EAT36071.1    HQ857158    AEM60160.1    KQ978473    KYM93709.1    GAKP01015845    JAC43107.1    GDHF01024367    GDHF01004609    JAI27947.1    JAI47705.1    HQ245152    AEB91341.1    EFZ18947.1    CH379063    EAL32572.2    CH916370    EDW00244.1    CVRI01000019    CRK90469.1    EDW00243.1    ATLV01012991    KE524833    KFB37100.1   
Pfam
PF00732   GMC_oxred_N        + More
PF05199   GMC_oxred_C
Interpro
IPR036188   FAD/NAD-bd_sf        + More
IPR007867   GMC_OxRtase_C       
IPR000172   GMC_OxRdtase_N       
IPR012132   GMC_OxRdtase       
SUPFAM
SSF51905   SSF51905       
Gene 3D
PDB
5NCC     E-value=1.98365e-42,     Score=435

Ontologies

Topology

Length:
497
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.30628
Exp number, first 60 AAs:
0.16241
Total prob of N-in:
0.08279
outside
1  -  497
 
 

Population Genetic Test Statistics

Pi
197.770849
Theta
156.920209
Tajima's D
0.970061
CLR
0.076671
CSRT
0.647767611619419
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 TPQAFWADATYQNIVQEIGDQKR 95.45 9e-12
27102218 AQIDGIENTPYR 95.45 9e-12
25860555 EIDDVIAFGK 100.00 6e-10
24093152 VVDSGVIPR 100.00 6e-10
27102218 AEYPDCKDIQFDSDEYWECAVR 100.00 6e-10
25860555 HVVYIGGQDGIYTFDYTTK 100.00 0.002
25860555 GMVGTFR 100.00 0.011
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号