SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09576
Pre Gene Modal
BGIBMGA013008
Annotation
hypothetical_protein_KGM_15612_[Danaus_plexippus]
Location in the cell
Cytoplasmic   Reliability : 1.106
 

Sequence

CDS
ATGATTGGAATTAGAGCATTTGAAGAAGACTACGACATTGAATATTACGATGACTTGCCGGAAAATCATTATCACAAAGAGGGAAGATCGTTTTCGTATCCCCAGAGTCCGATTATAGATTTGATTATGAAAACAGCGGCCCCTAATTATGTACCGAAAAATTCTGGAGACATTTTTGACTTTTTGAGAGATTCGTATCCGCTGCCTGGAGGACTGCACAGCCCTTATCATGAATACGATTTCGTAATCATAGGGGCGGGCTCAGCGGGCTCCGTTTTAGCTTCTAGACTAACAGAGGATAAGAACACCACGGTCTTGCTTATAGAGGCCGGGAAGCCAGAAATGATATTAACTGACATTCCAATTATGGCACCATATTTTCAATCAACAGAATATGCCTGGCAGTACTACATGGAACCCCAACCTGGAGTTTGTAAAGGTATGATCAACGGTCGTTGTTTTTGGCCGCGCGGGAAGGCGGTCGGGGGTAGCAGCGTCATCAACTACATGATATACACGCGGGGTAGACCACAAGACTGGGACAGGATCGCGGCCGCAGGGAATTATGGATGGTTTGAAAATAATTTTAATTTATTTTAA
Protein
MIGIRAFEEDYDIEYYDDLPENHYHKEGRSFSYPQSPIIDLIMKTAAPNYVPKNSGDIFDFLRDSYPLPGGLHSPYHEYDFVIIGAGSAGSVLASRLTEDKNTTVLLIEAGKPEMILTDIPIMAPYFQSTEYAWQYYMEPQPGVCKGMINGRCFWPRGKAVGGSSVINYMIYTRGRPQDWDRIAAAGNYGWFENNFNLF

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
Pfam
PF00732   GMC_oxred_N        + More
PF05199   GMC_oxred_C
Interpro
IPR036188   FAD/NAD-bd_sf        + More
IPR007867   GMC_OxRtase_C       
IPR000172   GMC_OxRdtase_N       
IPR012132   GMC_OxRdtase       
SUPFAM
SSF51905   SSF51905       
Gene 3D
PDB
5OC1     E-value=1.94892e-18,     Score=223

Ontologies

Topology

Length:
199
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.07459
Exp number, first 60 AAs:
0.00019
Total prob of N-in:
0.05064
outside
1  -  199
 
 

Population Genetic Test Statistics

Pi
258.664659
Theta
202.941238
Tajima's D
0.776303
CLR
0.046435
CSRT
0.593570321483926
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号