SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09574  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA013007
Annotation
Glucose_dehydrogenase_[acceptor]_[Papilio_machaon]
Location in the cell
Mitochondrial   Reliability : 3.348
 

Sequence

CDS
ATGGTGGCCACGACTAAGCTCATCAAAGCATTTTTAGAGGCCGGTAGAATCTTTGGACATCCAACAATTGATTACAATTCACCGCACCAATTAGGATTCGGTTATGTGCAAGCTATAACAACCAAAGGACACCGACAAAGTGCTGCGAAAGTATTCCTGCATAGACAGAAGAAGCGACAAAACTTACACATCTTGCCGGACACATACGTCACTAAAATACTCATAGATGCTCGAACTAAGACAGCCTATGGAGTCGAATACGTACGAAACAGATTAAAGCACATTGTACTAGCACGAAAAGAAGTAATTCTATCAGCCGGTCCCATAGCGTCTCCTCAGCTACTTATGTTATCCGGCGTGGGGCCTAAAAAACACTTAAATTCAATGGGCATACCGGTTCTCAAAGATCTGCCAGTTGGTAAAATGCTATACGATCATATTTGTTTCCCGGGGCTTATATTCGAACTCAACACAACCGATGTCAGCTTGCACGAAAGTAAAATGTTAAGAGTGCGACCTATACTTCAGTGGTTAAAGAATGGTGATAGTACACTATCATCTCCGGGTGGCGTGGAAGGAATCGGTTATATCAAAACTCCGATCTCCAACGATCCAGATCCTATACCAGATATTGAACTAATCAGTATCGGTGGATCTATACTCTCAGATGGTGGGCCTGGAGGCAGTAGAGCAGTTCGAAGAGGAATGAGAATTAGGGATGCAGTTATAGATGAGGCTTTTGGATCAATAGATAGAGTCGCAAGAGATACTTGGAGTGCTTTTATTATGTTGCTACACCCAGTTTCATTTGGGCGAATAGAGCTTAAAAATAAAAACCCATTTAGTCATCCCCGGATGTATGGAAATTATTTAACTCATTCGAAGGATGTAGTAACAATTATTGCTGGGATACGATACGTACAGGCTATGGCGGCAACATTCCCTTTCCAGAAGTTTGGTGCAAAAATACACAAAGCGTCCTATCCAACTTGCCGACACATACCGTTTGATTCGGATGAGTACTGGGAATGCGCTATTCGCACCCTCACTGCTACTTTGCACCACCAGATTGCGACGTGTCGAATGGGACCAAACAATGATCCATTAGCAGTTGTAGACCCAGAACTAAGAGTATATGGGATCGAAAAACTGCGGGTCGTAGATTCAGCAGTTATACCACGAACTATATCTGCTCATACACATGCACCCGCAATGATGATCGCTGAAAAAGCTGCTGATATGATCAAAGCTACATGGGCATCAATGCTACCTAATTACATTTCCTATTCATAA
Protein
MVATTKLIKAFLEAGRIFGHPTIDYNSPHQLGFGYVQAITTKGHRQSAAKVFLHRQKKRQNLHILPDTYVTKILIDARTKTAYGVEYVRNRLKHIVLARKEVILSAGPIASPQLLMLSGVGPKKHLNSMGIPVLKDLPVGKMLYDHICFPGLIFELNTTDVSLHESKMLRVRPILQWLKNGDSTLSSPGGVEGIGYIKTPISNDPDPIPDIELISIGGSILSDGGPGGSRAVRRGMRIRDAVIDEAFGSIDRVARDTWSAFIMLLHPVSFGRIELKNKNPFSHPRMYGNYLTHSKDVVTIIAGIRYVQAMAATFPFQKFGAKIHKASYPTCRHIPFDSDEYWECAIRTLTATLHHQIATCRMGPNNDPLAVVDPELRVYGIEKLRVVDSAVIPRTISAHTHAPAMMIAEKAADMIKATWASMLPNYISYS

Summary

Cofactor
FAD
Similarity
Belongs to the GMC oxidoreductase family.
EMBL
BABH01003831    BABH01003829    BABH01003830    ODYU01006526    SOQ48459.1    RSAL01000051    + More
RVE50271.1    KQ460323    KPJ15970.1    KQ458756    KPJ05260.1    RVE50270.1    NWSH01001458    PCG71170.1    AGBW02007651    OWR55011.1    JTDY01001201    KOB74558.1    RSAL01000001    RVE55122.1    KZ149911    PZC78108.1    JTDY01004843    KOB67682.1    AGBW02014789    OWR41062.1    AK402758    BAM19368.1    KPJ05259.1    KPJ15971.1    KQ459603    KPI92808.1    KQ460883    KPJ11152.1    OWR55012.1    ODYU01002091    SOQ39165.1    JTDY01000138    KOB78646.1    BABH01003834    CVRI01000064    CRL05333.1    KQ971348    EFA05534.2    HQ857158    AEM60160.1    CH477290    EAT44645.1    JXUM01024564    KQ560694    KXJ81241.1    NEVH01013984    PNF27957.1    AJVK01032026    UFQS01000369    UFQT01000369    SSX03246.1    SSX23612.1    SSX03245.1    SSX23611.1    KK853018    KDR12457.1    KYB26873.1    DS235131    EEB12342.1    HQ245146    AEB91347.1    GAPU01000071    JAB84774.1    GL436992    EFN71295.1    KQ435703    KOX80330.1    GEDC01013151    JAS24147.1    AAAB01008844    EAA45200.5    APCN01003125    KQ434869    KZC09314.1    CVRI01000019    CRK90469.1    AXCM01002814    ADTU01026680    KZ288238    PBC31353.1    GGMS01001005    MBY70208.1    QOIP01000012    RLU15835.1    DS235784    EEB16960.1    GL441651    EFN64469.1    HQ857157    AEM60159.1    KQ759784    OAD62863.1    KQ976532    KYM81568.1    AXCM01005241    GL448571    EFN84154.1    KQ981281    KYN43299.1    APCN01000325    GGMR01016673    MBY29292.1    GL763984    EFZ18946.1    KQ979701    KYN19666.1    GEBQ01031043    JAT08934.1    GBHO01043105    JAG00499.1    AAAB01008859    EAA07534.5    JTDY01003720    KOB69096.1    GL434548    EFN74792.1    GL888048    EGI68822.1    KQ414579    KOC71135.1    EAT44646.1    ABLF02037922    GFXV01004112    MBW15917.1    NEVH01005904    PNF38176.1    AJVK01058966    KQ982937    KYQ49100.1    ADMH02001672    ETN61477.1    DS231832    EDS31770.1    EFZ18947.1   
Pfam
PF05199   GMC_oxred_C        + More
PF00732   GMC_oxred_N
Interpro
IPR036188   FAD/NAD-bd_sf        + More
IPR000172   GMC_OxRdtase_N       
IPR007867   GMC_OxRtase_C       
IPR012132   GMC_OxRdtase       
SUPFAM
SSF51905   SSF51905       
Gene 3D
PDB
5NCC     E-value=1.77532e-31,     Score=340

Ontologies

Topology

Length:
430
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.310919999999999
Exp number, first 60 AAs:
0.000900000000000001
Total prob of N-in:
0.02775
outside
1  -  430
 
 

Population Genetic Test Statistics

Pi
216.391486
Theta
157.441179
Tajima's D
1.023049
CLR
0
CSRT
0.664766761661917
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
29197581 IQDIGVENTEENR 100.00 2e-05
25860555 KDEVPSAR 100.00 4e-04
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号