SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09552
Annotation
PREDICTED:_uncharacterized_protein_K02A2.6-like_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 2.608
 

Sequence

CDS
ATGCCGATTGGGAAAGTTGAAAGTTTTGATATGGGATCCCAAAATTGGGACACATACATTCGTCGTGTAAAACAATTTATGGAACTCAACGACATTGAACAGAGACTTCACGTTGCAACGCTCGTGACCTTAGTTGGGTCTGAGTGCTATGACTTAATGTGTGACTTGTGTGCTCCGGACTTACCAGAAGAAAAGGATTTCGACATACTCGTAAAATTAGTCAAAGATCATCTAGAACCTGAAAGATCGGAAATAGCAGAACGTCATATCTTCAGGCAAAGAAAGCAGCAAAATAACGAAAGCATTCGTTCCTACCTACAAAGTTTGAAACATTTGGCTAAAACTTGCAATTTCGGCATCACACTAGAAATTAATCTACGCGATCAATTCGTATCAGGATTATATAGTGAGGAGATGCGGTCAAGGCTGTTTGCTGAAAAAGATATAGATTACAAGCGCGCTGTTGAGTTAGCATCAGCACTGGAAGCAGCGGATCGACATGCGATGGCGGCTGGGGGCACTGGGGGCAGCTCACAGGCTGCGTCCGAGAGCGATGGCATGCATCGGGTCGGCGGAGCGCGCGCGGAGGCTCGCTGCGCCTGCAGACGCTGCGGCAAGCTGGGCCATGCGGAGGGTCGGTGTCGGTACAAGCACTACACCTGTGACTCATGTGGCGAGAAGGGACATCTAAAATCAATGTGTCGGAACCGTAAAGGTAACCAAAAGATTGAAAAAACCCGAGTTCATATACAGGCGATGTAA
Protein
MPIGKVESFDMGSQNWDTYIRRVKQFMELNDIEQRLHVATLVTLVGSECYDLMCDLCAPDLPEEKDFDILVKLVKDHLEPERSEIAERHIFRQRKQQNNESIRSYLQSLKHLAKTCNFGITLEINLRDQFVSGLYSEEMRSRLFAEKDIDYKRAVELASALEAADRHAMAAGGTGGSSQAASESDGMHRVGGARAEARCACRRCGKLGHAEGRCRYKHYTCDSCGEKGHLKSMCRNRKGNQKIEKTRVHIQAM

Summary

Similarity
Belongs to the complex I LYR family.
EMBL
NWSH01004348    PCG65197.1    GDQN01007099    JAT83955.1    ODYU01000701    SOQ35910.1    + More
NWSH01000218    PCG78288.1    JTDY01015222    KOB51965.1    JTDY01012655    KOB52243.1    JTDY01001749    KOB72999.1    JTDY01006045    KOB66341.1    JTDY01003118    KOB70119.1    JTDY01001428    KOB73878.1    RSAL01000130    RVE46453.1    GEZM01051399    JAV74971.1    JTDY01002326    KOB71659.1    GEZM01096178    JAV55085.1    GEZM01096180    JAV55080.1    JTDY01004038    KOB68679.1    GEDC01013717    JAS23581.1    JTDY01008052    KOB64775.1    GEDC01021971    JAS15327.1    LSMT01000299    PFX20902.1    LSMT01000298    PFX20931.1    GEDC01023506    GEDC01023205    JAS13792.1    JAS14093.1    GEDC01007675    GEDC01003661    JAS29623.1    JAS33637.1    LSMT01001234    PFX12679.1    GACK01000385    JAA64649.1    GGMR01013781    MBY26400.1    NCKU01014527    RWR99571.1    GFJQ02007084    JAV99885.1    HADZ01011823    HAEA01016148    SBP75764.1    HAEB01010230    SBQ56757.1    HADX01010638    SBP32870.1    JYDW01000462    KRZ48138.1    LSMT01000354    PFX19571.1    GEZM01036245    JAV82862.1    JYDK01000935    KRX51560.1    JYDK01000986    KRX51372.1    JYDN01000036    KRX62729.1    GEFM01006397    JAP69399.1    JYDI01000154    KRY50253.1    JYDQ01000335    KRY08440.1    LSMT01000297    PFX20955.1    NCKV01030579    RWS19072.1    KL367545    KFD65042.1    GEHC01001477    JAV46168.1    AGCU01195578    JYDN01000181    KRX54109.1    GEBQ01003960    JAT36017.1    JYDW01000348    KRZ48953.1   
Pfam
PF03732   Retrotrans_gag        + More
PF00078   RVT_1
PF17919   RT_RNaseH_2
PF17921   Integrase_H2C2
PF00665   rve
PF00098   zf-CCHC
PF17917   RT_RNaseH
PF05347   Complex1_LYR
PF00929   RNase_T
PF12796   Ank_2
Interpro
IPR036875   Znf_CCHC_sf        + More
IPR001878   Znf_CCHC       
IPR005162   Retrotrans_gag_dom       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR012337   RNaseH-like_sf       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR000477   RT_dom       
IPR041373   RT_RNaseH       
IPR008011   Complex1_LYR       
IPR001995   Peptidase_A2_cat       
IPR001969   Aspartic_peptidase_AS       
IPR002110   Ankyrin_rpt       
IPR013520   Exonuclease_RNaseT/DNA_pol3       
IPR020683   Ankyrin_rpt-contain_dom       
IPR036770   Ankyrin_rpt-contain_sf       
SUPFAM
SSF57756   SSF57756        + More
SSF50630   SSF50630       
SSF53098   SSF53098       
SSF48403   SSF48403       
Gene 3D

Ontologies

Topology

Length:
253
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.02113
outside
1  -  253
 
 

Population Genetic Test Statistics

Pi
478.044223
Theta
201.038963
Tajima's D
4.314188
CLR
0
CSRT
0.999650017499125
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号