SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09543
Pre Gene Modal
BGIBMGA012819
Annotation
PREDICTED:_uncharacterized_protein_LOC101744375_isoform_X2_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 4.911
 

Sequence

CDS
ATGACGATCCAGAACAGTACGACGGTCGTGCACATGTTCATTGTACTGTCAAGTTTCCTTACTGCTCACAATCTGTTAAGGTCAGACAAACAGTTTGGTTTCGGTACATTCTTAAGGTTGCTCGCGAAAAGAATAATTAGATTGAGCCCTGTGTGTTTATTGGTGATCGGTTTCGCCGGGACCTGGTGGCCCCGGGTCAGTGACGGACCTCTGTGGCCGGCTGCGGTCGCGGAGCAGAGTAAGATCTGCCGCGAGAAGTTCTGGTCGCACGCGTTATTCATCAATAACCTGGTGGAACCGGACAAGTTCTGTTTGTTACCGACCTGGTATATAGCGGTCGACATGCAGATGTCCATACTAGCAGCTATCTTAACAATGATCCTGGCCAAGTTCAGTAAGAAAGCTGTGCCGATTCTCGTGATTCTATTCATAGGAGCCATAGTGTTGAATGCAGGCTTGGCGTACATACACGAATGGAAGTCAATGTTGTATTTTGCAACAGTCACAGAGTGA
Protein
MTIQNSTTVVHMFIVLSSFLTAHNLLRSDKQFGFGTFLRLLAKRIIRLSPVCLLVIGFAGTWWPRVSDGPLWPAAVAEQSKICREKFWSHALFINNLVEPDKFCLLPTWYIAVDMQMSILAAILTMILAKFSKKAVPILVILFIGAIVLNAGLAYIHEWKSMLYFATVTE

Summary

EMBL
BABH01003924    JTDY01002748    KOB70794.1    NWSH01000045    PCG80260.1    BABH01004270    + More
BABH01004271    AGBW02007654    OWR54851.1    KQ459582    KPI98971.1    KZ149997    PZC75398.1    KQ460635    KPJ13421.1    LADJ01024181    KPJ21123.1    KPJ13420.1    ODYU01009435    SOQ53859.1    PCG80259.1    ODYU01003108    SOQ41449.1    ODYU01002360    SOQ39759.1    NWSH01000169    PCG78819.1    KPI98970.1    KZ150097    PZC73595.1    PCG80257.1    PZC75396.1    PZC75399.1    PCG80263.1    KPI98974.1    OWR54852.1    DS232017    EDS31995.1    AGBW02008687    OWR52781.1    ODYU01007420    SOQ50174.1    NWSH01001667    PCG70475.1    CH478459    EAT32956.1    KZ150068    PZC74094.1    DS233096    EDS28047.1    CH478446    EAT32977.1    ADMH02001642    ETN61640.1    GGFL01005669    MBW69847.1    KPJ13425.1    AXCN02000448    AXCN02000449    CH477316    EAT43757.1    CVRI01000004    CRK87301.1    OWR54850.1    RSAL01000205    RVE44373.1    AAAB01008900    EAA09563.4    AAAB01008846    EAU77249.3    GDHF01015522    JAI36792.1    JXUM01082219    JXUM01082220    JXUM01082221    JXUM01082222    JXUM01082223    JXUM01082224    JXUM01082225    KQ563298    KXJ74104.1    GDHF01026027    JAI26287.1    ODYU01008317    SOQ51800.1    GAKP01021925    GAKP01021923    JAC37029.1    APCN01002909    AXCN02001004    GAMC01012119    JAB94436.1    AGBW02013856    OWR42649.1    PZC74096.1    APCN01001143    GAPW01001480    JAC12118.1    NEVH01017478    PNF24171.1    KQ972879    KXZ75738.1    AXCN02001261    AGBW02009017    OWR51851.1    GECU01009231    JAS98475.1    AXCM01001275    SOQ50171.1    GGMS01004866    MBY74069.1    JXUM01076912    JXUM01076913    JXUM01076914    JXUM01076915    KQ562977    KXJ74719.1    CCAG010022781    DS235172    EEB12973.1    CH964291    EDW86401.2    JXJN01015181    AAAB01008807    EAA03947.5    CH964232    EDW80558.2    GEZM01074205    GEZM01074204    JAV64641.1   
Pfam
PF01757   Acyl_transf_3        + More
PF00089   Trypsin
PF00246   Peptidase_M14
PF00497   SBP_bac_3
Interpro
IPR002656   Acyl_transf_3        + More
IPR009003   Peptidase_S1_PA       
IPR001254   Trypsin_dom       
IPR006621   Nose-resist-to-fluoxetine_N       
IPR034223   IGCP-like_CPD       
IPR000834   Peptidase_M14       
IPR001638   Solute-binding_3/MltF_N       
SUPFAM
SSF50494   SSF50494       

Ontologies

Topology

Length:
170
Number of predicted TMHs:
3
Exp number of AAs in TMHs:
78.40448
Exp number, first 60 AAs:
30.06916
Total prob of N-in:
0.28764
POSSIBLE N-term signal
sequence
inside
1  -  44
TMhelix
45  -  64
outside
65  -  105
TMhelix
106  -  128
inside
129  -  134
TMhelix
135  -  157
outside
158  -  170
 
 

Population Genetic Test Statistics

Pi
185.478395
Theta
153.363094
Tajima's D
0.188148
CLR
0.012041
CSRT
0.418929053547323
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号