SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09513
Pre Gene Modal
BGIBMGA012813
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.532
 

Sequence

CDS
ATGTTGCGATCTGAGGTTTTGCGGGCCTTGAAAGCTGCTAAAACAGGTAAATCACCGGGTCCTGATAATATACCGATCGAAATACTAAAGTTGCTGGAAGAAGATCAACTGGACGTTCTCACACAGTTCTTCAACAACATCTACGAAACAGGCAATCTTCCTAGTGACTGGCTAAAATCCACATTCATTACGATACCCAAGAAGCAAAATGCCAAAAAATGTGGAGAGTATCGTATGATTAGTCTGATGAGCCATGTCCTAAAAGTATTCTTGAACATCATACAGAATAGAATACGGCCAAAATGTGATGAACAACTGGGCGATAGCCAATTTGGATTTCGATCTGGTGTTGGCACCAGAGAAGCTCTTTTCGCTCTCAACGTTCTCGTACAGAAATGCAGAGACATGCAAACTGATGTCTTTTTGTGCTTCATAGACTACGAAAAGGCATTTGACCGAGTTAAACATCATCAACTTTTTAGCCTTTTATGTGACATTGGTCTAGATGGTAAGGACGTCAGAATCATCCGCAACCTGTACGAGAAGCAGGTGGCTACGATAAGAGTCGAAAATGAGGAAACCGACCAAGTTGAGATCTGTCGTGGGGTCCGGCAGGGTTCAAGCGTATCTGTAGCTGGGAAACAACTAGAGCGGGTACGACAGTACAAGTATTTAGGGGCTTGGGTAAACGAAGCATGGGAATCTGATCAAGAAATCAAGACCCGGATAGAAACTGCTCGAGCCTCTTTTAATAAAATGAGGAAAGTTCTTTGCTGTCGTCAACTGAATATAAAGCTCCGAGTCAGGCTACTCATGTGCTATATCTGGCCTATCGTCATGTATGGTTGCGAAACGTGGACCCTGAAAGAGGACACTACAAGACGCCTACAGGCATTCGAGATGTGGTGCTACCGTCGCATGTTACGCATTGGTTGGACGCAGAGGGATTGA
Protein
MLRSEVLRALKAAKTGKSPGPDNIPIEILKLLEEDQLDVLTQFFNNIYETGNLPSDWLKSTFITIPKKQNAKKCGEYRMISLMSHVLKVFLNIIQNRIRPKCDEQLGDSQFGFRSGVGTREALFALNVLVQKCRDMQTDVFLCFIDYEKAFDRVKHHQLFSLLCDIGLDGKDVRIIRNLYEKQVATIRVENEETDQVEICRGVRQGSSVSVAGKQLERVRQYKYLGAWVNEAWESDQEIKTRIETARASFNKMRKVLCCRQLNIKLRVRLLMCYIWPIVMYGCETWTLKEDTTRRLQAFEMWCYRRMLRIGWTQRD

Summary

Pfam
PF00078   RVT_1        + More
PF03372   Exo_endo_phos
PF14529   Exo_endo_phos_2
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D
PDB
5HHL     E-value=0.000504702,     Score=101

Ontologies

GO

Topology

Length:
316
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.02657
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03145
outside
1  -  316
 
 

Population Genetic Test Statistics

Pi
183.522515
Theta
147.707631
Tajima's D
0.762157
CLR
0.127927
CSRT
0.594920253987301
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号