SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09403
Pre Gene Modal
BGIBMGA001193
Annotation
PREDICTED:_uncharacterized_protein_LOC106135401_[Amyelois_transitella]
Location in the cell
Mitochondrial   Reliability : 1.719
 

Sequence

CDS
ATGCATAAAGACAGCCAGATACAGCCGTCGATACTGCCTCGGGTGCCGTGTGCTGTAACTGCTGATGCTCATTCACAAACCCAGAGTGTTATCCATACTCTGGACGATTTGGCATCTTACAAAAATAAAATTCCTGTGCTTAAGCACATCCCTAAGGGGGCCAGGAATTTAGTCGCAGGAAAGCTCAGAGTGATTATGGACGGCTGCATAAACAATAACGGTGTGGCGGACTGGGTTTCCTTGTTGTCATTTTCTTACACGACTCTGAGAATTCCAGATCGAGGTGACCCCCGTTCGCTTACTGCAAAGGTTAAGGAGAATGCAAACAATAATAGCCCGTATTTTTTAGAGGACTTCAAACACAAGCCACGATCCATTGTCAAAAGAATCGAAGCCAAGGTTCATGAGGGTGATTTGCGTGGAGCTGTCCGTCTTTTAGTGTCGGAGGATTCTTTAGCACCTTTTAACGATGAGACCTTAAGCGCATTACGTGATAAACATCCTACTCCTTTTCGTCCCTTATCATTGCCGCCAGCGCCTGATTCTAGTTGCCCTTTTTTGACTGTCAACTCGGAGGATGTTGCAGACGCAATTAGTTCCTTTTATAGCGGCTCTGCACCTGGCCTTGATGGTCTACGTCCAAACCATTTAAAGGAGCTCATTTCCCCTTCCGCCGGTGAAAATGGTGTTCGTCTATTGCACTCAATTACAGACTTATGCAATTTCATACTAAGAGGTACGGTTAATGTACAGGTGTGTCCTTATTTGTACGGAGGTAGCTTATGCGCTCTAACTAAGAAGGACGGCGGTGTGAGACCAATTGCGGTGGGGTCTGTGCTGCGTCGTCTCGCTGCCAAGCTTGGGTGTCGGTCTGTAAGGAATGAAATGGCCTCGTACTTGCAGCCCCACCAGCTGGGCTTCGGGACTGCTCTTGGGTGTGAGGCCGCCATTCATGCTACCCGTGCATTTGCTATGAGCAGGGAGAGCTGTAACAGTGCAATTGTAAAGCTTGATATAAGGAATGCTTTTAATAGCTTAGAGAGAGATATAATTTTAAATGAAATCAAGGAAAAGATTCCGGCTTTATACCCATTCTTGTATCAGTGTTACAGCTCTTCCAGCAAGTTATTCTTTATGAAATCTTCCATTGACTCAGAGGTAGGTGCCCAGCAGGGCGATCCTCTTGGCCCATTAATTTTTAGTCTTGCTATCCACAGCATTATAAAGACCGTCAAGTCACCTTTAAACCTATGGTATTTAGATGACGGCACAATAGGTGGTCCCCCAGATTCCGTGCTAGACGACATCAGACTTTTATTTCCGAAGTTGCGAGATGTCGGCTTGGAGCAAGCGTAG
Protein
MHKDSQIQPSILPRVPCAVTADAHSQTQSVIHTLDDLASYKNKIPVLKHIPKGARNLVAGKLRVIMDGCINNNGVADWVSLLSFSYTTLRIPDRGDPRSLTAKVKENANNNSPYFLEDFKHKPRSIVKRIEAKVHEGDLRGAVRLLVSEDSLAPFNDETLSALRDKHPTPFRPLSLPPAPDSSCPFLTVNSEDVADAISSFYSGSAPGLDGLRPNHLKELISPSAGENGVRLLHSITDLCNFILRGTVNVQVCPYLYGGSLCALTKKDGGVRPIAVGSVLRRLAAKLGCRSVRNEMASYLQPHQLGFGTALGCEAAIHATRAFAMSRESCNSAIVKLDIRNAFNSLERDIILNEIKEKIPALYPFLYQCYSSSSKLFFMKSSIDSEVGAQQGDPLGPLIFSLAIHSIIKTVKSPLNLWYLDDGTIGGPPDSVLDDIRLLFPKLRDVGLEQA

Summary

Similarity
Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family.
Pfam
PF00078   RVT_1        + More
PF00628   PHD
PF02257   RFX_DNA_binding
PF00096   zf-C2H2
PF00858   ASC
PF03184   DDE_1
PF00001   7tm_1
PF00400   WD40
Interpro
IPR000477   RT_dom        + More
IPR013087   Znf_C2H2_type       
IPR036388   WH-like_DNA-bd_sf       
IPR011011   Znf_FYVE_PHD       
IPR013083   Znf_RING/FYVE/PHD       
IPR001965   Znf_PHD       
IPR019787   Znf_PHD-finger       
IPR019786   Zinc_finger_PHD-type_CS       
IPR003150   DNA-bd_RFX       
IPR036236   Znf_C2H2_sf       
IPR001873   ENaC       
IPR004875   DDE_SF_endonuclease_dom       
IPR020903   ENaC_CS       
IPR036390   WH_DNA-bd_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR039779   RFX-like       
IPR036322   WD40_repeat_dom_sf       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR037151   AlkB-like_sf       
IPR017986   WD40_repeat_dom       
IPR001680   WD40_repeat       
IPR004263   Exostosin       
SUPFAM
SSF57903   SSF57903        + More
SSF57667   SSF57667       
SSF46785   SSF46785       
SSF50978   SSF50978       

Ontologies

Topology

Length:
451
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04791
Exp number, first 60 AAs:
7e-05
Total prob of N-in:
0.00768
outside
1  -  451
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号