SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09393  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012764
Annotation
prophenoloxidase-1_[Bombyx_mori]
Full name
Phenoloxidase subunit 1       + More
Phenoloxidase 2      
Alternative Name
PO 1
Tyrosinase 1
proPO-P1
Phenoloxidase subunit A3
Processed phenoloxidase A3
Location in the cell
Cytoplasmic   Reliability : 1.377 Nuclear   Reliability : 1.406
 

Sequence

CDS
ATGTCTGACGCCAAGAAAAACCTGTTACTGTTCTTCGACCGTCCCTCAGAGCCATGCTTCATGCAAAAGGGAGAAGACAAGGCAGTATTCGATATTCCTGACAATTACTACCCGGAGAAGTACCAGCGTGTGTCAAATGCTATAAGCAACAGGTTCGGTAGCGACGCGGGCCGCATGATACCCATCAGGAACATTGCCCTGCCCAATCTGGACCTGCCCATGGAACTGCCCTACAACGAGCAGTTCTCCTTGTTCGTCCCTAAACACAGGCAAATGGCAGGAAAGCTGATTGATATCTTCATGGGAATGCGTGACGTAGAAGATCTCCAGAGTATCTGTGCGTACTGCCAACTGCGGATCAATCCCTATATGTTCAATTATTGCCTCTCCGTCGCCATCTTGCATAGATCAGACACGAAAGGTTTGCAAATCCCAACCTTTGCTGAGTGCTTTCCCGATAAGTTCATGGACCCGAAGGTGTTCCGCAAAGCCAGAGAAGTGACCAGCGTTGTACCGACTGGAGCCAGGATGCCAATAGTGATTCCGTCGAACTACACCGCGTCGGACGCGGAGCCGGAGCAGCGCGTGGCGTACTTCCGCGAGGACATCGGCACCAACCTGCACCACTGGCACTGGCACCTCGTGTACCCCTTCGACGCCGCAGACCGCGCCCTCGTCAACAAGGACCGCCGCGGGGAGCTCTTCTACTACATGCACCAGCAGATGATCGCCAGATTCAACATCGAACGATTCTGCAACGACCTGAGGAAAGTGGAAACCTACAGTGACTTCAGGGGTCCCATTAAAGAGGGCTACTTCCCTAAGATGGACTCGCAAGTTGCCAGCAGAGCCTGGCCTCCTAGATTTGCTGGTTCGTTTCTCCGTGACTTAGACAGACCGATAGACCAGATCAGAATCGATATCTCTGAGCTGGAGATCTGGAGGGACAGGTTTCTGAAGGCGATCGAGGATATGGCAGTGATCCTGCCCAATGGGCGTCAAATGCCTCTGGACGAAGAGACTGGTATTGACGTGCTGGGTAACCTGATGGAATCGTCCACCATCAGTATAAACCGCCCATACTACGGTGACCTCCACAACATGGGGCACGTCTTTATCGGGTACTGCCACGACCCTGATCATCGTCATCTGGAACCGTTCGGCGTGATGGGAGACCTGGCAACGACCATGCGTGACCCATTGTTCTTTCGCTGGCATGGATACATAGATTCTGTTTTCCACCTCTACAAGTACAAACTTACACCTTATAGCGATGATAGGCTGATCTTCCCCGACATCAGGGTTCGGTCCATTAGTCTCGATGGTAAAGGAGCTCCCAACATGCTGAATACTTTCTGGGAGCAGAGTACTGTGGACTTGGCTCGTGGCTTGGACTTTAGTCCCCGTGGCAGTGTTCTGGCCAGGTTCACTCATCTACAGCATGAAGACTACAGTTATGTGATCGAAGTGAATAACACGGGCCGCAGTAGTGTCATGGGCATGTTTAGGATATTCATCGCCCCAACACTTGACGAGAATAAGCGGCCTCTGAACTTCGACGAGCAACGGAAACTCATGATCGAACTCGACAAGTTCTCACAGGGCTTGAAGCCCGGCAACAATACAGTACGTCGTCGCAGTGTGGACTCCTCAGTGACCGTTCCGTTCGAGAGGACATTCAGCAACCAGGCTGACAGGCCAGGTAATCCGGGATCTCCCGAGTCCGCCGAGTTTGACTTCTGCGGCTGCGGGTGGCCTCAGCACATGCTGATACCCAAGGGAACCACTGAAGGATATCCTATGGTGCTGTTTGTCATGGTGTCCAACTGGAACGATGACCGGGTGGAGCAAGACCTGGTGGGGTCGTGCAATGATGCGGCGTCGTACTGCGGCATCCGCGACCGCAAGTACCCGGACCGGCGCGCCATGGGCTTCCCGTTCGACCGGCCCGCGCCCGCCGCCACCACGCTGTCCGACTTCCTGCGCCCCAACATGGCCGTGCGCGACTGCATCGTACGCTTCACCGACAGGACCCGCCAGCGCGGCCAGCAGGAGTAG
Protein
MSDAKKNLLLFFDRPSEPCFMQKGEDKAVFDIPDNYYPEKYQRVSNAISNRFGSDAGRMIPIRNIALPNLDLPMELPYNEQFSLFVPKHRQMAGKLIDIFMGMRDVEDLQSICAYCQLRINPYMFNYCLSVAILHRSDTKGLQIPTFAECFPDKFMDPKVFRKAREVTSVVPTGARMPIVIPSNYTASDAEPEQRVAYFREDIGTNLHHWHWHLVYPFDAADRALVNKDRRGELFYYMHQQMIARFNIERFCNDLRKVETYSDFRGPIKEGYFPKMDSQVASRAWPPRFAGSFLRDLDRPIDQIRIDISELEIWRDRFLKAIEDMAVILPNGRQMPLDEETGIDVLGNLMESSTISINRPYYGDLHNMGHVFIGYCHDPDHRHLEPFGVMGDLATTMRDPLFFRWHGYIDSVFHLYKYKLTPYSDDRLIFPDIRVRSISLDGKGAPNMLNTFWEQSTVDLARGLDFSPRGSVLARFTHLQHEDYSYVIEVNNTGRSSVMGMFRIFIAPTLDENKRPLNFDEQRKLMIELDKFSQGLKPGNNTVRRRSVDSSVTVPFERTFSNQADRPGNPGSPESAEFDFCGCGWPQHMLIPKGTTEGYPMVLFVMVSNWNDDRVEQDLVGSCNDAASYCGIRDRKYPDRRAMGFPFDRPAPAATTLSDFLRPNMAVRDCIVRFTDRTRQRGQQE

Summary

Description
This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6 dihydroxyindole to indole-5'6 quinone. Binds to the surface of hemocytes and is involved in hemocyte melanization.
This is a copper-containing oxidase that functions in the formation of pigments such as melanins and other polyphenolic compounds. Catalyzes the rate-limiting conversions of tyrosine to DOPA, DOPA to DOPA-quinone and possibly 5,6 dihydroxyindole to indole-5'6 quinonee (By similarity).
Catalytic Activity
2 L-dopa + O2 = 2 H2O + 2 L-dopaquinone
L-tyrosine + O2 = H2O + L-dopaquinone
Cofactor
Cu(2+)
Subunit
Heterodimer.
Heterodimer. Forms a complex with an interleukin 1-like protein as a consequence of a host defense response.
Similarity
Belongs to the tyrosinase family.
Keywords
Complete proteome   Copper   Direct protein sequencing   Disulfide bond   Glycoprotein   Melanin biosynthesis   Metal-binding   Monooxygenase   Oxidoreductase   Reference proteome   Secreted   Zymogen   3D-structure  
Feature
chain  Phenoloxidase subunit 1
EC Number
1.14.18.1
EMBL
BABH01004242    BABH01004243    BABH01004244    AF178462    AAG09304.1    BABH01004245    + More
D49370    BAA08368.1    EU569724    ACC69184.1    AB778568    BAM76811.1    DQ289581    ABB92834.1    DQ841706    NWSH01000045    ABH10016.2    PCG80267.1    KY744277    ATD13326.1    KP974690    ALE19971.1    AY665397    AAU29555.1    AF003253    AAC05796.1    AGBW02007654    OWR54842.1    EU046570    EU046571    EU046572    ABW16859.1    ABW16861.1    KQ459582    KPI98957.1    KT006134    ANH58159.1    GU199189    ACZ97553.1    GU214206    ADA60206.1    JF342362    AEA92682.1    KQ460635    KPJ13408.1    HM776513    ADL14486.1    KJ803014    AII22868.1    HM026570    ADG65539.1    AF336289    AAK64363.1    KX452359    AQM36768.1    KX437622    AQM36767.1    KPI98962.1    KPI98959.1    U86875    AAC34251.1    JTDY01006889    KOB65615.1    KPI98958.1    KPJ13410.1    AY494738    AAR84669.1    GBXI01017411    JAC96880.1    CVRI01000070    CRL07388.1    JX110850    AFP81886.1    GAMC01009964    GAMC01009963    JAB96591.1    GDHF01011142    JAI41172.1    JRES01000975    KNC26576.1    AF161260    AAD45526.1    KNC26577.1    GDHF01026318    JAI25996.1    GAKP01021407    JAC37545.1    CH478340    MH810192    EAT33194.1    QBC65457.1    DS231964    EDS29448.1    KNC26609.1    JXJN01019700    CH954177    EDV59434.1    KNC26607.1    CM000157    EDW89439.1    KNC26610.1    KQ971348    KYB26937.1    CCAG010007845    AAAB01008859    EAA07521.2    APCN01000572    APCN01000573    CH940648    EDW59888.1    AY884064    AAX84205.1    L76038    AF031626    AAC27383.1    AAD01936.1    EFA05662.1    AE013599    AY060652    AB055857    ADMH02002195    ETN57874.1    CH480816    EDW47034.1    AXCN02000327    CM002911    KMY92407.1    OUUW01000001    SPP74446.1    CH964154    EDW79825.1    CM000071    EAL25684.2    CH479183    EDW36098.1    JX987235    AGC54940.1    CH916367    EDW01791.1    JX987234    AGC54939.1    CH902619    EDV35932.1   
Pfam
PF03722   Hemocyanin_N        + More
PF03723   Hemocyanin_C
PF00372   Hemocyanin_M
PF01401   Peptidase_M2
Interpro
IPR036697   Hemocyanin_N_sf        + More
IPR005203   Hemocyanin_C       
IPR000896   Hemocyanin/hexamerin_mid_dom       
IPR002227   Tyrosinase_Cu-bd       
IPR005204   Hemocyanin_N       
IPR014756   Ig_E-set       
IPR013788   Hemocyanin/hexamerin       
IPR037020   Hemocyanin_C_sf       
IPR008922   Unchr_di-copper_centre       
IPR001548   Peptidase_M2       
SUPFAM
SSF48056   SSF48056        + More
SSF48050   SSF48050       
SSF81296   SSF81296       
PDB
3HHS     E-value=0,     Score=2796

Ontologies

Topology

Subcellular location
Secreted  
Length:
685
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00904999999999998
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00049
outside
1  -  685
 
 

Population Genetic Test Statistics

Pi
233.154432
Theta
178.527119
Tajima's D
0.937009
CLR
0.27623
CSRT
0.639018049097545
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28467696 TFSDENFK 97.14 1e-19
29197581 SVDSSVTVPFER 97.14 1e-19
31223520 MPIVIPSNYTASDAEPEQR 100.00 3e-07
31223520 AIEDMAVILPNGR 100.00 2e-06
24402669 MPEATCDVPVPVQETHSVCDFSACYCDPGTVR 100.00 2e-06
28467696 MPIGFPIDREIDVPNFYTSNMK 100.00 2e-06
29197581 MDSQVASR 100.00 2e-06
28467696 GECEIDSQCSDHIACVGYQCVDPCIGNTQCGSGAVCMAR 100.00 3e-05
29197581 GAPNMINTFWEQSTVDIAR 100.00 3e-05
31250652 DAAVQLLADMYRHVAPSAAPAGR 100.00 2e-04
26822097 IIFPDIR 100.00 0.023
25044914 AVESGFPFGFSIEQVR 100.00 0.023
24402669 AVESGFPFGFSIEQVR 100.00 0.023
28467696 AVESGFPFGFSIEQVR 100.00 0.023
29197581 AREVTSVVPTGAR 100.00 0.023
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号