SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09351
Annotation
PREDICTED:_neuroligin-4?_Y-linked-like_[Bombyx_mori]
Full name
Carboxylic ester hydrolase      
Location in the cell
Extracellular   Reliability : 2.231
 

Sequence

CDS
ATGACCGTATTGGAAATAATAAAAGAGGGAACAAACTGTACTGTGAGTGTACGAGATGCTGTAGCCCGATATCCAGTGTTGGTCTTCGTCCACGGGGAGAGTTACGAGTGGAGTTCTGGAAACCCCTACGATGGGACAGTGTTGGCTTCTCACGCGGGACTAGTTGTGGTCACAATTAACTACAGACTTGGGATTTTGGGATTCCTCAACCCTAGATCCGATGACTACCCTCGGTCGCCAGCCAACTATGGTCTCATGGACCAAATTGCCGCCTTGCACTGGATCAAGGAAAACGTGGCGGTTTTTGGTGGAGATCCTACTAACGTCACTCTAATGGGACATGGCACCGGGGCTGCCTGCGTCCATTTCCTGCTCACCTCTTTAGCTGTGCCTGAAGCTACTGTCTGTTTTGCAGATGTCCAACACGAGATTTAA
Protein
MTVLEIIKEGTNCTVSVRDAVARYPVLVFVHGESYEWSSGNPYDGTVLASHAGLVVVTINYRLGILGFLNPRSDDYPRSPANYGLMDQIAALHWIKENVAVFGGDPTNVTLMGHGTGAACVHFLLTSLAVPEATVCFADVQHEI

Summary

Similarity
Belongs to the type-B carboxylesterase/lipase family.
EC Number
3.1.1.-
EMBL
RSAL01000253    RVE43466.1    KZ150175    PZC72572.1    NWSH01000626    PCG75183.1    + More
GEYN01000068    JAV02061.1    KQ461195    KPJ06806.1    KQ459581    KPI99138.1    GL443020    EFN62695.1    APGK01037806    APGK01037807    APGK01037808    KB740949    ENN77160.1    GEDC01004998    JAS32300.1    KQ414602    KOC69648.1    ABLF02032237    ABLF02032238    ABLF02032239    ABLF02032241    KB631852    ERL86735.1    GEZM01006945    JAV95539.1    KK853310    KDR08664.1    KQ982727    KYQ51600.1    KQ978577    KYN30056.1    KQ981676    KYN38141.1    GL452201    EFN77791.1    KQ976697    KYM77538.1    KQ977231    KYN04724.1    KQ971342    KYB27546.1    KK107238    EZA54819.1    DS235184    EEB13057.1    KZ288193    PBC34132.1    CH477264    EJY57452.1    JRES01001621    KNC21491.1    GL888172    EGI66119.1    GFXV01000644    GFXV01005935    MBW12449.1    MBW17740.1    FJ580049    ACM48187.1    BT030437    ABO52857.1    AAZX01004420    AAZX01004645    AAZX01007714    AAZX01009171    AAZX01010230    AAZX01010833    AAZX01012199    AAZX01012817    AAZX01014915    AAZX01022750    GEDC01011305    JAS25993.1    GGMR01006184    MBY18803.1    GGMS01016248    MBY85451.1    CH964232    EDW81356.2    KJ702211    AID61365.1    BT024454    ABC86516.1    CH954181    EDV48163.1    ACPB03005614    GAMC01002586    JAC03970.1    CH480821    EDW55251.1    GBBI01002710    JAC16002.1    CH902617    EDV41851.2    KPU79385.1    KPU79386.1    AE014297    AAF53999.3    AAF54000.3    CH940652    EDW59551.2    OUUW01000008    SPP84093.1    CH933806    EDW14187.2    GEBQ01025751    JAT14226.1    CH479185    EDW38172.1    JXUM01102273    JXUM01102274    KQ564714    KXJ71855.1    CM000070    EDY68528.2    CM000364    EDX12005.1    AXCM01016645    GDHF01028241    JAI24073.1    CH916369    EDV93359.1    CM000160    EDW96352.2    ADMH02001760    ETN61158.1    CP012526    ALC45331.1    GL732645    EFX68935.1    PYGN01000971    PSN38825.1    GDIQ01143313    GDIQ01141464    JAL10262.1    AXCN02000135    GDIQ01173691    JAK78034.1    GDIP01156174    JAJ67228.1    GDIQ01031156    JAN63581.1    GDIQ01029609    JAN65128.1    GDIQ01214887    JAK36838.1    GDIQ01020416    JAN74321.1    LRGB01002190    KZS08483.1    GDIP01080073    JAM23642.1    GDIP01018760    JAM84955.1    GDIQ01159857    JAK91868.1    GFDL01003836    JAV31209.1    UFQS01000893    UFQT01000893    SSX07525.1    SSX27865.1    GEBQ01026256    JAT13721.1    AAAB01008888    EAL40590.4    DS235124    EEB12234.1    HACA01001453    CDW18814.1    LBMM01014885    KMQ85014.1    DS231953    EDS28805.1    GBHO01000458    JAG43146.1    CVRI01000024    CRK92270.1    KY021888    AQY62777.1   
Pfam
PF00135   COesterase
Interpro
IPR019819   Carboxylesterase_B_CS        + More
IPR002018   CarbesteraseB       
IPR029058   AB_hydrolase       
IPR000460   Nlgn       
IPR019826   Carboxylesterase_B_AS       
SUPFAM
SSF53474   SSF53474       
Gene 3D
PDB
3BE8     E-value=3.17404e-28,     Score=305

Ontologies

Topology

Length:
144
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
5.81873
Exp number, first 60 AAs:
3.23906
Total prob of N-in:
0.12007
outside
1  -  144
 
 

Population Genetic Test Statistics

Pi
238.306858
Theta
194.772686
Tajima's D
1.266896
CLR
0.356561
CSRT
0.731313434328284
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号