SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09339
Annotation
reverse_transcriptase_[Bombyx_mori]
Full name
ATP-dependent DNA helicase      
Location in the cell
Cytoplasmic   Reliability : 1.705 Mitochondrial   Reliability : 1.605
 

Sequence

CDS
ATGGAAGACGGGGCGCCACCCTGGGACCTGGAGGCGGAGGCGCTCGCTGCCGATTACCGGTGGCGTAGCGACCTTCGCTCTAGGGGGGAAGGGCGCCCCGGCGAAGGAGTAGTTCGAGCGCGGAGGCTCCAATCTCGGCGGTCCGTGCTGGAGGCGTGGTCTCGCCGCTTGGCGGACCCGTCGGCCGGCCTCCGTACCGTCGAGGCGGTCCGCCCGGTTCTCGCGGACTGGGTAGGCCGCGACCGCGGATGCCTCACCTTCCGGCTGACGCAAATGTTGACCGGCCATGGTTGTTTTGGCCGGTACTTGCACAAGATAGCCGGAAGGGAACCGACGGCGCAGTGCCACCACTGCGCGGACCGCGACGAGGATGACACAGCGGAACACACATTGGCGCGTTGCTCTGGTTTCGACGAGCAACGCGCCGCCCTCGTCGCGGTCATAGGAGAGGACCTCTCGCTGCCGCGCGTCGTGGCTACGATGCTCGGCAGCGACGCGTCCTGGAAGGCGATGCTCGACTTCTGCGAGTCCACCATCTCGCAGAAGGAGGCGGCGGAGCGAGAGGGAGAGCTCTTCCCTTTCCGCACCGATCCGTCGCCGTCGAGCCGGGGGCCGGAGGCAGGAATACGCCCGTACGTCCCGGCCCCTGTAGGTAGCGGCCTCCCCCCGGTGAAGGTCAAGGGGCGACCTGAGGGGGTGAGGCCGCGCGGCGCGCTACCAGCACTCTAG
Protein
MEDGAPPWDLEAEALAADYRWRSDLRSRGEGRPGEGVVRARRLQSRRSVLEAWSRRLADPSAGLRTVEAVRPVLADWVGRDRGCLTFRLTQMLTGHGCFGRYLHKIAGREPTAQCHHCADRDEDDTAEHTLARCSGFDEQRAALVAVIGEDLSLPRVVATMLGSDASWKAMLDFCESTISQKEAAEREGELFPFRTDPSPSSRGPEAGIRPYVPAPVGSGLPPVKVKGRPEGVRPRGALPAL

Summary

Catalytic Activity
ATP + H2O = ADP + H(+) + phosphate
Cofactor
FAD
Mg(2+)
Similarity
Belongs to the GMC oxidoreductase family.
Belongs to the helicase family.
EC Number
3.6.4.12
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF07776   zf-AD
PF00096   zf-C2H2
PF00732   GMC_oxred_N
PF05970   PIF1
PF00059   Lectin_C
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR036188   FAD/NAD-bd_sf       
IPR012132   GMC_OxRdtase       
IPR000172   GMC_OxRdtase_N       
IPR016187   CTDL_fold       
IPR010285   DNA_helicase_pif1-like       
IPR016186   C-type_lectin-like/link_sf       
IPR001304   C-type_lectin-like       
IPR018378   C-type_lectin_CS       
IPR027417   P-loop_NTPase       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF51905   SSF51905       
SSF52540   SSF52540       
SSF56436   SSF56436       
Gene 3D
PDB
4XVM     E-value=0.0555576,     Score=82

Ontologies

Topology

Length:
242
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00198
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01004
outside
1  -  242
 
 

Population Genetic Test Statistics

Pi
59.630572
Theta
39.068785
Tajima's D
1.231666
CLR
1.049358
CSRT
0.723413829308535
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号