SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09337
Pre Gene Modal
BGIBMGA002172
Annotation
PREDICTED:_neuroligin-4?_X-linked-like_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.59
 

Sequence

CDS
ATGCTGAGGACCAGAGTAATCGGCACTCGCTACGGAAAACTCCAAGGGGTAATTTTACCTATGGATCAGCACAAGTACTTGAAACCTGTCGAGGCGTACCTCGGGGTGCCATATGCCACACCACCCACGGGTTCTAACAGATTTGCGCCAACACGAGCTCCAGCACCATGGGATGAGGTGAAAATGGTGGACCAAATGGGACCAGTCTGCCCACAGAGACTGCCGGATATTTCGAACGAGACCTTAGCTTTAGAGAGAATGCCTAAGGGACGTCTGGAATACTTAAGGAGATTGCTTCCTCGGCTTAAGAATCAGAGTGAAGACTGTCTATATATGAACATCTATACACCAGTTCAAGTTGGGCCAACGCTCCAAGCCAAGTACCCAGTAATCGTTTTCATTCACGGGGAGTCTTTCGAATGGAATTCCGGTAATGTTTACGATGGCTCCGTGTTGGCTAGCTACGCTGGATTAGTTGTTATCACCATCAATTACAGGCTCGGTATCCTTGGTAAGTATAATAATACTTTTGGATAA
Protein
MLRTRVIGTRYGKLQGVILPMDQHKYLKPVEAYLGVPYATPPTGSNRFAPTRAPAPWDEVKMVDQMGPVCPQRLPDISNETLALERMPKGRLEYLRRLLPRLKNQSEDCLYMNIYTPVQVGPTLQAKYPVIVFIHGESFEWNSGNVYDGSVLASYAGLVVITINYRLGILGKYNNTFG

Summary

EMBL
RSAL01000099    RVE47591.1    KZ150139    PZC72958.1    KQ460154    KPJ17231.1    + More
KQ459581    KPI99129.1    AGBW02014763    OWR41088.1    GEYN01000074    JAV02055.1    KQ971342    KYB27544.1    DS235124    EEB12234.1    JXJN01007432    AAAB01008879    EAA44773.5    CH479185    EDW38294.1    KJ702186    AID61340.1    CM000364    EDX12253.1    CH954181    EDV48409.1    JRES01001389    KNC23200.1    CH892041    EDX00131.2    CH902617    KPU79345.1    CH940650    EDW66773.2    GBHO01000458    JAG43146.1    CH480842    EDW49693.1    AE014297    AAF55745.4    ACZ94957.1    AHN57419.1    CH933806    EDW15559.2    BT050584    ACJ23468.1    ACZ94958.1    ODYU01003066    SOQ41368.1    KRG01621.1    KRG01622.1    GAMC01006682    GAMC01006681    JAB99873.1    KRG01620.1    CM000070    EDY68564.3    OUUW01000008    SPP83978.1    CH964251    EDW83324.2    NNAY01000326    OXU29206.1    CP012526    ALC46886.1    CH916373    EDV95063.1    BABH01029721    BABH01029722    BABH01029723    BABH01029724    RVE47584.1    KQ981676    KYN38135.1    GGMR01018148    MBY30767.1    GGMS01006704    MBY75907.1    FJ580050    ACM48188.1    DS235184    EEB13057.1    ODYU01001227    SOQ37150.1    KP308206    ALH43424.1    NWSH01000115    PCG79397.1    KZ150096    PZC73599.1    AJWK01025848    AJWK01025849    AJWK01025850    AJWK01025851    AJWK01025852    AJWK01025853    AJWK01025854    AJWK01025855    GEDC01023812    JAS13486.1    GEBQ01006118    JAT33859.1    CH940652    EDW59551.2    AGBW02008258    OWR53904.1    GBBI01002710    JAC16002.1    AXCN02000135    GFDL01003836    JAV31209.1    KQ461195    KPJ06806.1    KZ288345    PBC27591.1    KZ150175    PZC72572.1    GEYN01000068    JAV02061.1    FJ580049    ACM48187.1    NWSH01000626    PCG75183.1    ALC45331.1    CAEY01000897    CAEY01000898    KPI99138.1    GEBQ01025751    JAT14226.1    GGMS01016248    MBY85451.1    GL732645    EFX68936.1    EFX68935.1    AAAB01008888    EAL40590.4    GDIQ01031156    JAN63581.1    GEDC01015441    JAS21857.1    LRGB01002190    KZS08483.1    GDIP01080073    JAM23642.1    GDIQ01214887    JAK36838.1    GDIQ01029609    JAN65128.1    GDIQ01162852    GDIQ01162851    GDIQ01162848    JAK88877.1    GDIQ01046892    GDIQ01046891    JAN47845.1    GDIQ01042744    GDIQ01040096    JAN51993.1    GDIQ01162849    JAK88876.1    GDIQ01048446    JAN46291.1    GDIQ01162850    JAK88875.1    GDIQ01109513    JAL42213.1    GDIQ01061845    JAN32892.1    GDIQ01176290    GDIQ01173991    GDIQ01143158    GDIQ01143157    GDIQ01141462    GDIQ01141461    GDIQ01057538    JAN37199.1    GDIQ01097275    GDIQ01097274    JAL54452.1    GDIQ01079183    GDIQ01079182    JAN15555.1    GDIQ01048447    JAN46290.1    GDIQ01048449    GDIQ01048448    JAN46288.1    GDIP01083331    JAM20384.1   
Pfam
PF00135   COesterase
Interpro
IPR002018   CarbesteraseB        + More
IPR029058   AB_hydrolase       
IPR019819   Carboxylesterase_B_CS       
IPR000460   Nlgn       
IPR000997   Cholinesterase       
SUPFAM
SSF53474   SSF53474       
Gene 3D
PDB
3BE8     E-value=2.05957e-34,     Score=360

Ontologies

Topology

Length:
178
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
15.87626
Exp number, first 60 AAs:
0.00331
Total prob of N-in:
0.68605
outside
1  -  178
 
 

Population Genetic Test Statistics

Pi
197.28607
Theta
177.028023
Tajima's D
0.577163
CLR
148.910693
CSRT
0.539623018849058
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号