SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09331
Annotation
PREDICTED:_uncharacterized_protein_LOC106138993_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 2.272
 

Sequence

CDS
ATGGTGGCTTTGATCGATACAGGTAGTGACGCGAATCTTATTATACAATCAGAATTTGAAAAAATTGAAAATAGTATCCAACATTATGACAAGAATTCAGAAGTTCGTCTTACGGGTATTGCTAACAAAGAAGTACTTGTCAAAGGTGTTTTTACTACTCAGCTACAGATTGATGATGCTGTTACGGATATCAAATTTTACATTGTGGAAGATGATATAATACCTGTAAAGCTGATCATTGGCAACCCCATACTGCGTGAATTCGAAGTTAAGTTTACAAGAAATGGTATTGTAATGGAGAAGATTCCACTTTGTGCTATTGTTGTTGAGAAGGACGAGGTCAAAGAAGATTACAAGAAGTTAGAGAAAGAAGATTATAAGAAGTTAGAGAAAGAAGACTGCAAGAAGTTGGTTAAAGTACCTTACCAGAATCATTTGACACAAAATAAAATACTGTACAAAGAGAAGAATGGAAGTAGTTTTATCGCTGTACCAAAGAAGATGGATAAAGAAATTAGAAGACAGAATTATAGGAGAGGACGACTAAAAGTTGAAGATTGGGAATGGAGGAGGTCCGATACATACGACTAG
Protein
MVALIDTGSDANLIIQSEFEKIENSIQHYDKNSEVRLTGIANKEVLVKGVFTTQLQIDDAVTDIKFYIVEDDIIPVKLIIGNPILREFEVKFTRNGIVMEKIPLCAIVVEKDEVKEDYKKLEKEDYKKLEKEDCKKLVKVPYQNHLTQNKILYKEKNGSSFIAVPKKMDKEIRRQNYRRGRLKVEDWEWRRSDTYD

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
196
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00137
Exp number, first 60 AAs:
0
Total prob of N-in:
0.05964
outside
1  -  196
 
 

Population Genetic Test Statistics

Pi
260.719242
Theta
134.971661
Tajima's D
4.390803
CLR
0
CSRT
0.9998000099995
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号