SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09259  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA003292
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.535 PlasmaMembrane   Reliability : 1.208
 

Sequence

CDS
ATGTTGGCTCTAAGCTTGGCCGTGGCTGTCGCAGCCAACTTGTTCGCTTCGACTGTATGCACCAAGAACTACACTGAAGCTCAGCTTAGATTTTATGATGCCAACACTGGCCTGTGTGGAATAGGCATTGACCAATGGTTTCAATATGAACCCGAGAGGAATCAGTTCTCCACAGCGATTCCACTATTGTTCATGTTGAGTGAACTCTCCTTAAACAGCAAAGAGGATACTACAGCGGAACTGTACAAAAACCTTAATTTGCAATCTGAAGATGAGGTCGTATACGTCAACCAGGCCGTCAACACAAATTTAAATACAAAGAACGAGATTTACCAATCGACTCTGATATTGAACGCCTTCACTGACATCGATTCTCCGTTCTCTGAAACCTTCATACAAAATTTCGCTAAAGTTTTCAACGGAACTGTTAAAAATATTGACTATAGTAATGATGCCGTCGCAACTATCAGGGATTCACTACAAAGCGACAGTGGAAACGACATGGAAATTGCTCTGAAAGACGGCGATATCAATAAGGACACCGGTATAATTCTCACAGCTTACACTAACATTTATTTCCCATGGGGCCAAGCTAGCGACTCATACCGCCCGTACAAGCAGATCGACATTTCATTCACAGCACTAGACGGAACACAAAGTAATAAACAAGCATGGTACTCGGAGGGTGCGGGAAAATACGCGGAAATCGAAAATCTTGGCATCAAGGTCTTCCAGTATTCTTTGAGACCTGGTCTTTCCGTCGTCTTGGGGACTGCATTAAATGACAACAAGGATCTTAGCGGCGCATTTAACAAACTCCGCGATCCCGCGACGCTGGCGTATATCTTGACTCAAACCGAGTCTAAATACTTGAAGCTCGCAGTTCCGGTCGAATTTCCGTTGAGAGATTCACGTGATTATGTACCTGAAATTAAAAGGGCCGGACTCTTGACAGAGCTTTTTGAGAAAAACTTCGACGGCTTCGATACGGTCTATGACAATAAATCAGGATATATATCCTACATGTTGAGTCATACACGTATTGACTTCGAACAGCCCACAGAAGAGCGTCCGAGAAGTTGGGGCCTCGCCGCAAGGCGAGTGTTTTCAAGACCCGGGGCCGCCCCACCTGGGTACTCAGCGATCATGGACGCTGTATTCGCGGAATTCCTCCGACTTCGCCACCCACAGCTCGCCTCGGAGTTTCTGGCCTTCAAGGCCAATCACACTGCGAGCCCTCTCGGGGACTCCGCCGCGCTCGCTGCTCCTGCGTCGCCTGTACCTGCGTGCAGAGCTTCTGCATTGAGCACCGCAGCCTCTGTCGTGCCTGCCGCTCCCGTGTCGCCTATACTGGCGAGAAAAGCTGCTGCGTCGTCCGCCGTGACCATCGTTTCAGCTGAGCGATCATCCGCGGCCTCCGTCGCGCCCTCTAAAACACCTACACTTGCTCGTAGGTCGCCTGCACCCGCCTCCTCGTGCTCCGACTCTGACTCGGACATGGAGGTCGACCTCGCCCCCGCCTCATCGACGGATGGATTCACCCTGGTACAGAAGGGTAAGAAGCGTGCCGCGGAGTCTCGAGCTCCCGCGGCCGCTAAAATTAGCAAAGCCGTGAACGCGTCACGCCCCCGCCCTCAGACTCCCGTTGCGCCCCCAGCCCGTGCCACTCCGTCGCCGCGTCCGGTGGCACAAAATAAAACCCAGACCCCTCCCCCGGTTATCCTTCAGGAGAAGGCAGCTTGGGATCGAGTTTGCCTAGCCCTTAAGGCCAAAAATATAAATTTCACGAATGCCCGTAACCTCAAGAACGGCATTCAAATTAAGGTTCAAACACCCGACGACCATAGGGCCCTCTCTTCTTACCTCCGTAAGGAGCGTATAAGTTTCCATACGTATACGCTCCAGGAGGAGCGCGAACTCCGCGTTGTAATACGCGGAATCCCTAAAGAGTTAGATGTAGAGCTCGTAAAAGCCGACCTGTTAGAACAAGGCCTACCAGTGAATTCTGTGCACCGTATGCACACCGGTCGCGGTAGGGAGCCATATAATATGGTTCTAGTCGCTCTCCAGCCTACCCCCGAGGTGCAGGAGACCCTACTTAAGCCCGCGCGCCGTGACCCTAAAATCGCGAACTATAACATGGTCAGGAACGACAGGCTCTCTGCCCGTGGTGGTGGTACCGTCATTTACTATAGAAGAGCCCTGCATTGCGTCCCGCTCGATCCTCCCGCGCTCGCTAATATCGAAGCATCAGTGTGCCGAATCTCACTGACGGGACACGCGCCGATCGTTATCGCGTCCGTTTATCTTCCACCGGATAAGATCGTTCTAAGCAGTGATATCGAGGCGCTGCTCGGTATGGGGAGCTCTGTCATTCTGGCGGGCGACCTAAATTGTAAACACATCAGGTGGAACTCACACACCACAACCCCGAATGGCAGGCGGCTTGACGCGTTAGTCGATGATCTCGCCTTCGATATCGTCGCTCCGCTAACCCCGACTCACTACCCGCTAAATATCGCGCATCGCCCGGATATACTCGACATAGCGTTATTAAAAAACGTAACTCTGCGCTTACACTCGATTGAAGTAGTTTCAGAGTTAGATTCAGACCACCGTCCCGTCGTTATGAAGCTCGGTCGCGCTCCCGATTCCGTTCCCGTCACGAGGACTGTGGTGGATTGGCACACGCTGGGCATCAGCCTGGCTGAATCTGATCCACCATCGCTCCCGTTTAACCCGGACTCTACCCCGTCTCCTCAGGATACCGCTGAAGCCATAGACATCTTAACATCACACATCACCTCGACATTAGATAGGTCATCGAAACAAGTTGTAGCGGAGGACTTCCTTCACCGCTTCAAATTGTCCGACGATATAAGGGAACTCCTTAGAGCTAAGAACGCCTCGATACGCGCCTACGACAGTACTCAATCCGTGGACCCTGTTCATGTAGAATTAGTAGACAGTGAGGTAGAACGCAGAGCCTCCTTGCCACCCTCGGATGCGTTACCACCCGTCACCCCGATGGAAGTTAAAGACTTGATCAAAGACCTACGTCCTCGCAAGGCTCCCGGTTCCGACGGTATATCTAACCGCGTTATTAAACTTCTACCCGTCCAACTCATCGTGATGTTGGCATCTATTTTCAATGCCGCTATGGCGAACTGTATCTTTCCCGCGGTGTGGAAAGAAGCGGACGTTATCGGCATACATAAACCCGGTAAACCAAAAAATCATCCGACGAGCTACCGCCCGATTAGCCTCCTCATGTCTCTAGGCAAACTGTATGAGCGTCTGCTCTACAAGCGCCTCAGAGATTTCGTCTCATCCAAGGGCATTCTCATCGATGAACAATTCGGATTTCGTACAAATCACTCATGCGTTCAACAGGTGCACCGCCTCACGGAGCACATTCTTGTGGGGCTTAATCGACCAAAACCGTTATACACGGGAGCTCTCTTCTTCGACGTCGCAAAAGCGTTCGACAAAGTCTGGCACAATGGTTTGATTTTCAAACTATTCAACATGGGCGTGCCGGATAGTCTCGTGCTCATCATACGGGACTTCTTGTCGAACCGCTCTTTTCGATATCGAGTCGAGGGAACCTGCTCCTCCCCACGACCTCTCACAGCTGGAGTCCCGCAAGGCTCTGTCCTCTCACCCCTCCTATTTAGCTTATTCGTCAACGATATTCCCCGGTCGCCGCCGACCCATTTAGCTTTATTCGCCGACGACACGACTGTTTACTATTCTAGTAGAAATAAGTCCCTAATCGCGAAGAAGCTTCAGAGCGCAGCCCTAGCCCTAGGACAGTGGTTCCGAAAATGGCGCATAAACATCAACCCAGCGAAAAGTACTGCGGTGCTATTTCAGAGGGGAAGCTCCACACGGATTTCCTCCCGGATTAGGAGGAGGAATCTCACACCCCCGATTACTCTCTTTAGACAACCCATACCCTGGGCCAGGAAGGTCAAGTACCTGGGCGTTACCCTGGATGCATCGATGACATTCCGCCCGCATATAAAATCAGTCCGTGACCGTGCCGCGTTTATTCTCGGTAGACTCTACCCCATGATCTGTAAGCGGAGTAAAATGTCCCTTCGGAACAAGGTGACACTTTACAAAACTTGCATAAGGCCCGTCATGACTTACGCGAGTGTGGTGTTCGCTCACGCGGCCCGCACACACATAGACACCCTCCAATCCCTACAATCCCGCTTTTGCAGGTTAGCTGTCGGGGCTCCGTGGTTCGTGAGGAACGTTGACCTACACGACGACCTGGGCCTCGAATCAATTCGGAAATACATGAAGTCAGCGTCGGAACGATACTTCGATAAGGCTATGCGTCATGATAATCGCCTTATCGTTGCCGCCGCTGACTACTCCCCGAATCCTGATCATGCAGGAGCCAGTCACCGTCGACGCCCTAGACACGTCCTTACGGATCCATCAGATCCAATAACCTTTGCATTAGATGCCTTCAGCTCTAATACTAGGGGCAGGCTTAGGGACCCCGATGGTCTGACAGAGTGCGAAATAACGAAGTCTTGCGACGTGCCAATGTTGGTGGCATTTAATGCGATGGCAGCTTCAGTGGTGCGGTCATGTATCACGCATGGCGGGGGAAAAGTGGCGAAGCGCATCTTCTTCTCTGAACTGCAAGACGGCAAGCGAAAGCATGGCGGACAGCTCCTCCGGTACAAAGATGTCGTGAAACGACACATGAAGAGATGTGTTAAAGACCCCTCTCAATGGGAGCGCTTGGTAGCACAGCGACCAGAATGGTGCAAGATGCTGAACAAAGCAAAACAAACAAACCAAAGTGATAAATTCAACTTGGCCTGTATTATTGGATCGTATATAAAAGCTCTGAATCGGTTAGCCAACATTAGTTGTTGCAGCAGATTGTTCGTGATCATGTTGGCTCTAAGCTTGGTCGTGGCTGTCGCAGCCAACTTGTTCGCTTCGACTGTATGCGCCCAGAACTACACTGAAGCTCAGCTTAAATATTATGATGCCAACACTGGCCTGTGTGGAATAGGCATCGACCAATGGTTTCAATATGAACCCGAAAGGAATCAGTTCTCCACAGCGTTTCCACTATTGTTCATGTTGAGTGAACTCTCCTTAAACAGCAAAGAGGATACTACAGCGGAACTGTACAAAAACCTTAATTTGCGATCGGAAGATGAGGCCGTCAACACAAATTTAAATACAAAGAACGAGGTTTACCAATCGACTCTGATATTGAACGCCTACACTGATATCGATTCTCCGTTCTCTGAAACCTTCATACAAAATTTCGCTAAAGTTTTCAATGGAACCGTTAAAAATATTGACTATAGTAATGATGCCGTCGCAACAATCAGGGATTCACTACAAAGCGACAGTGGAAACGACATAGAAATTGCTCTGAAAGACGGCGATATCAATAAGGACACCGGTATAATTCTCACAGCTTACACTAACATTTATTTCCCATGGGGCGAAGCTAGCGACTCATACCGCCCGTACAAGCAGATCGACATTTCATTCACAGCACTAGACGGAACACAAAGTAATAAACAAGCATGGTACTCGGAGGGTGCGGGAAAATACGCGGAAATCGAAAATCTTGGCATCAAGGTCTTCCAGTTTTCTTTGAAACCTGGTCTTACCGTCGTCTTGGGGACTTCATTAAATGACAACAATGATCTTAGCGGCGCATTTAACAAACTCCGCGATCCCGCGACGCTGGCGTATATCTTGACGCAAACCGAGTCTAAATACTTGAAACTTGCAGTTCCGATCAAATTGACAATGAGAGATTCACGTGATTATATACCTGAAGTTAAAAGGATCTTCCAGTTTTATTTGAGAGGTGGTATTTCCGTCGTCTTGGGGACTTCATTAAATGACAACGAGGATCTTAGCGTCGCTTTTAACAAACTCCGCGATCCCGCGACGCTGCCGTATATCTTGACTCAAACCGAGTCTAAATACTTGAAGCTCGCAGTTCCGATCGAATTGACATTGAGAGATTCACGTGATTATGTACCTGAAGTTAAAAGGGCCGGACTCTTGACAGAGATTTTTGAGAAAAACTTCGACGGCTTCGATACGGTCTATGACAATAAATCAGGATATATATCCCATATGCTGAGCCATATGCGTATTGACTTCGAACAGCCCACAGAAGAGCGATTGGTGAAGGAAGGTGGCCCTGGGGCCTTTCCAGTTTCACCAGGACAGGTGGACGAGCAAAGGCTTAGCCAGAAGGGGTGGAATTTGCTAACAGCTGCTGGAGCGCATCCGAAGGACACCTATCAACTCAAGAGCAGTGATAAATTCAACTTGGCCTGTATTATTGGATCGTATATAAAAGCTCTGAATCGGTTAGCCAACATTAATTGTTGCAGCAGATTGTTCGTGATCATGTGGGCTCTAAGCTTGGCCGTGGCTGTCGCAGCCAACTTGTTCGCTTCCACTCTATGCACCCAGAACTACACTGAAGCTCGGCTTAGATTTTGTGAAGCCAACACTCGCCTGTGTGGAATAGGAATCGACCAATGGTTCCAATATGAACCCGAAAGGAATCAGGTCTCCAGAGCGCTTCCACTATTGTTCATGTTGAGTGAACTCTCCTTAAACAGCAAAGAGGATACTACAGCGGAACTGTACAAAAACCTTAATTTGCGATCGGAAGATGAGGTTGTAGGCGTCAACCAGATTGCCTACGAAAAGACAAATAAAAAGAACGAGGTTTACCAATCGACTCTGATATTGAACGCCTACACTGACATCGATTCTCCGTTCTCTGAAACCTTCATACAAAATTTCGCTAAAGTTTTCAATGGAACCGTTAAAAATATTGACTATTGTAATGATGCCGTCGCAACTATCAGGGATTCGCTACAAAGCGACAGTGGAAACGACATAGAAATTGCTCTGAAAGACGGCGACATCGATAAGGAAACCGGTATAATTCTCACAGCTTACACTAACATTTATTTACCATGGGGTCAAGCTAGCGACTCATACCGCCCGTACAAGCAGATCGACATTTCATTCACAGCACTAGACGGAACACAAAGTAATAAACAAGCATGGTACTCGGAGGGTGCGGGAAAATACGCGGAAATCGAAAATCTTGGCATCAAGATCTTCCAGTTTTATTTGAGAGGTGGTATTTCGGTCGTCTTGGGGACTTCATTAAATGACAACGAGGATCTTAGCGTCGCTTTTAACAAACTCCGCGATCCCGCGACGCTGCCGTATATCTTGACTCAAACCGAGTCTAAATACTTGAAGCTCGCAGTTCCGATCGAATTGACATTGAGAGATTCACGTGATTATGTACCTGAAGTTAAAAGGGCCGGACTCTTGACAGAGCTTTTTGAGAAAAACTTCGACGGCTTCGATACGGTCTATGACAATAAATCAGGATATATATCACATATGCTGAGCCATATGCGTATTGACTTCGAACAGCCCACAGAAGAGCAAGCTGAAAGCGTGGTTGCCGAGCCAGACTTCATCTTCAACAAGCCCTATTTCTTCTTGATTCTCAACAAATACAATGCACCAGGTTTCGTTGGCCTTATCACGCACTGA
Protein
MLALSLAVAVAANLFASTVCTKNYTEAQLRFYDANTGLCGIGIDQWFQYEPERNQFSTAIPLLFMLSELSLNSKEDTTAELYKNLNLQSEDEVVYVNQAVNTNLNTKNEIYQSTLILNAFTDIDSPFSETFIQNFAKVFNGTVKNIDYSNDAVATIRDSLQSDSGNDMEIALKDGDINKDTGIILTAYTNIYFPWGQASDSYRPYKQIDISFTALDGTQSNKQAWYSEGAGKYAEIENLGIKVFQYSLRPGLSVVLGTALNDNKDLSGAFNKLRDPATLAYILTQTESKYLKLAVPVEFPLRDSRDYVPEIKRAGLLTELFEKNFDGFDTVYDNKSGYISYMLSHTRIDFEQPTEERPRSWGLAARRVFSRPGAAPPGYSAIMDAVFAEFLRLRHPQLASEFLAFKANHTASPLGDSAALAAPASPVPACRASALSTAASVVPAAPVSPILARKAAASSAVTIVSAERSSAASVAPSKTPTLARRSPAPASSCSDSDSDMEVDLAPASSTDGFTLVQKGKKRAAESRAPAAAKISKAVNASRPRPQTPVAPPARATPSPRPVAQNKTQTPPPVILQEKAAWDRVCLALKAKNINFTNARNLKNGIQIKVQTPDDHRALSSYLRKERISFHTYTLQEERELRVVIRGIPKELDVELVKADLLEQGLPVNSVHRMHTGRGREPYNMVLVALQPTPEVQETLLKPARRDPKIANYNMVRNDRLSARGGGTVIYYRRALHCVPLDPPALANIEASVCRISLTGHAPIVIASVYLPPDKIVLSSDIEALLGMGSSVILAGDLNCKHIRWNSHTTTPNGRRLDALVDDLAFDIVAPLTPTHYPLNIAHRPDILDIALLKNVTLRLHSIEVVSELDSDHRPVVMKLGRAPDSVPVTRTVVDWHTLGISLAESDPPSLPFNPDSTPSPQDTAEAIDILTSHITSTLDRSSKQVVAEDFLHRFKLSDDIRELLRAKNASIRAYDSTQSVDPVHVELVDSEVERRASLPPSDALPPVTPMEVKDLIKDLRPRKAPGSDGISNRVIKLLPVQLIVMLASIFNAAMANCIFPAVWKEADVIGIHKPGKPKNHPTSYRPISLLMSLGKLYERLLYKRLRDFVSSKGILIDEQFGFRTNHSCVQQVHRLTEHILVGLNRPKPLYTGALFFDVAKAFDKVWHNGLIFKLFNMGVPDSLVLIIRDFLSNRSFRYRVEGTCSSPRPLTAGVPQGSVLSPLLFSLFVNDIPRSPPTHLALFADDTTVYYSSRNKSLIAKKLQSAALALGQWFRKWRININPAKSTAVLFQRGSSTRISSRIRRRNLTPPITLFRQPIPWARKVKYLGVTLDASMTFRPHIKSVRDRAAFILGRLYPMICKRSKMSLRNKVTLYKTCIRPVMTYASVVFAHAARTHIDTLQSLQSRFCRLAVGAPWFVRNVDLHDDLGLESIRKYMKSASERYFDKAMRHDNRLIVAAADYSPNPDHAGASHRRRPRHVLTDPSDPITFALDAFSSNTRGRLRDPDGLTECEITKSCDVPMLVAFNAMAASVVRSCITHGGGKVAKRIFFSELQDGKRKHGGQLLRYKDVVKRHMKRCVKDPSQWERLVAQRPEWCKMLNKAKQTNQSDKFNLACIIGSYIKALNRLANISCCSRLFVIMLALSLVVAVAANLFASTVCAQNYTEAQLKYYDANTGLCGIGIDQWFQYEPERNQFSTAFPLLFMLSELSLNSKEDTTAELYKNLNLRSEDEAVNTNLNTKNEVYQSTLILNAYTDIDSPFSETFIQNFAKVFNGTVKNIDYSNDAVATIRDSLQSDSGNDIEIALKDGDINKDTGIILTAYTNIYFPWGEASDSYRPYKQIDISFTALDGTQSNKQAWYSEGAGKYAEIENLGIKVFQFSLKPGLTVVLGTSLNDNNDLSGAFNKLRDPATLAYILTQTESKYLKLAVPIKLTMRDSRDYIPEVKRIFQFYLRGGISVVLGTSLNDNEDLSVAFNKLRDPATLPYILTQTESKYLKLAVPIELTLRDSRDYVPEVKRAGLLTEIFEKNFDGFDTVYDNKSGYISHMLSHMRIDFEQPTEERLVKEGGPGAFPVSPGQVDEQRLSQKGWNLLTAAGAHPKDTYQLKSSDKFNLACIIGSYIKALNRLANINCCSRLFVIMWALSLAVAVAANLFASTLCTQNYTEARLRFCEANTRLCGIGIDQWFQYEPERNQVSRALPLLFMLSELSLNSKEDTTAELYKNLNLRSEDEVVGVNQIAYEKTNKKNEVYQSTLILNAYTDIDSPFSETFIQNFAKVFNGTVKNIDYCNDAVATIRDSLQSDSGNDIEIALKDGDIDKETGIILTAYTNIYLPWGQASDSYRPYKQIDISFTALDGTQSNKQAWYSEGAGKYAEIENLGIKIFQFYLRGGISVVLGTSLNDNEDLSVAFNKLRDPATLPYILTQTESKYLKLAVPIELTLRDSRDYVPEVKRAGLLTELFEKNFDGFDTVYDNKSGYISHMLSHMRIDFEQPTEEQAESVVAEPDFIFNKPYFFLILNKYNAPGFVGLITH

Summary

Uniprot
ProteinModelPortal
PDB
4R9I     E-value=0,     Score=1687

Ontologies

GO

Topology

SignalP
Position:   1 - 16,         Likelihood:  0.801490
 
 
Length:
2531
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
41.30454
Exp number, first 60 AAs:
0.47125
Total prob of N-in:
0.02402
outside
1  -  2531
 
 

Population Genetic Test Statistics

Pi
268.619776
Theta
202.343218
Tajima's D
1.679974
CLR
0.48476
CSRT
0.824558772061397
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 ICPIICIINSCDCR 95.65 6e-12
24093152 YVPSEQR 95.65 6e-12
27102218 SEDEVVNVNQAVNTNINTK 95.65 6e-12
24093152 FWYENDNTAAR 95.65 8e-12
27102218 DSIQSDSGNDMEIAIK 95.65 8e-12
27102218 IRFCEANTR 95.83 5e-11
27102218 IRFCEANTR 95.83 5e-11
27102218 DGDIDKETGIIITAYTNIYIPWGQASDSYRPYK 95.24 9e-10
24093152 SEAQSVIEQCKDK 100.00 0.005
27102218 IAVPIEITIR 100.00 0.005
28467696 SECGTNSPCAGTAVVK 100.00 0.005
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号