SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09245
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.879
 

Sequence

CDS
ATGGTTAGAGTGAATGACGTCATCTCGGGACCTTTTAAGCCGGAAAAAGGTGTGCGACAGGGGTGCATACTTTCTCCTATTCTTTTCAATGTGTATGGAGAATATGTAATGAGAAAAGCCTTAGAGGACTGGGAGGGGGGCATCTCAGTCGGTGGCATAAAAATTAGCAATCTGAGATATGCGGACGATACCACGCTTTTCGCGTCATCTGAGAAGGAGCTTGCTGACCTATTCCGTAGAGTGGAGTATGAGAGTAGTTTGGTGGGGCTCTCCGTTAATAAGTCCAAAACAAAGGTCATGATAGTGGACAGAACCAGTCAACTCTCTAGAACTGGAGAGCTATCAGATCTAGAATTCGTCAGCGAGTTCATATACCTCGGGTCCTTACTGACCGACCGCGGAGGCAGTGAGGGAGAGATAAGGAGGAGGACGCAGATGGCCAAAACAGCGATGACCAAGCTCAAACGAATATGGCAAAATCGCAAAGTCTCTAACGTCACGAAAATGAGACTCGTCCGAACCTTAGTTTTCTCAATCTTTCTCTACGGGGCAGAGTCCTGGACAATTAAGGCATCCGAGCGCAAGAAAATAAACGCATTTGAAATGTGGTGCTGGAGACGAATGCTCCGAATTCCGTGGACGGCCAAGAGGACAAATAAATCTATCCTGGATCAGCTTCGCATCCGAGTCAGGCTCTCAACAATCTGTTACCAGAGGATCCTCAGCTACTTCGGTCATATTGCCCGCCGACAGTCAGATAACTTGGACAAAGTGATTGTGACGGGCAAAGTAGAAGGAAAGAGACCCCGCGGCCGATTACCTAGCCGTTGGTGTGATCAAGTAACCGCTCTAACTGGGTTGCCAGTCGCAACCACCATTCGAGCAGCTGAGGACCGGACGAGATGGAAACAGCTCACGAGACAGGCAACGGTCAAGTTTCAGGGACACGACCTTCAGCAATGA
Protein
MVRVNDVISGPFKPEKGVRQGCILSPILFNVYGEYVMRKALEDWEGGISVGGIKISNLRYADDTTLFASSEKELADLFRRVEYESSLVGLSVNKSKTKVMIVDRTSQLSRTGELSDLEFVSEFIYLGSLLTDRGGSEGEIRRRTQMAKTAMTKLKRIWQNRKVSNVTKMRLVRTLVFSIFLYGAESWTIKASERKKINAFEMWCWRRMLRIPWTAKRTNKSILDQLRIRVRLSTICYQRILSYFGHIARRQSDNLDKVIVTGKVEGKRPRGRLPSRWCDQVTALTGLPVATTIRAAEDRTRWKQLTRQATVKFQGHDLQQ

Summary

EMBL
FJ265546    ADI61814.1    FJ265548    ADI61816.1    FJ265553    ADI61821.1    + More
FJ265557    ADI61825.1    RSAL01000289    RVE42931.1    KZ150203    PZC72267.1    FJ265552    ADI61820.1    GU815090    ADF18553.1    FJ265547    ADI61815.1    FJ265560    ADI61828.1    MRZV01002322    PIK33998.1    ODYU01004401    SOQ44236.1    BDOT01000002    GCF39995.1    BDOT01000022    GCF45060.1    BDOT01000039    GCF47371.1    BDOT01000143    GCF52806.1    BDOT01000054    GCF48637.1    BDOT01000043    GCF47717.1    BDOT01000149    GCF53002.1    BDOT01000089    GCF50820.1    BDOT01000015    BDOT01000055    BDOT01000148    GCF44364.1    GCF48654.1    GCF52988.1    BDOT01000006    GCF41961.1    BDOT01000474    GCF58974.1    BDOT01000062    GCF49174.1    BDOT01000028    GCF46132.1    GCF48602.1    BDOT01000020    GCF44935.1    BDOT01000048    GCF48010.1    GCF40256.1    GCF47356.1    BDOT01000029    GCF46280.1    BDOT01000104    GCF51438.1    GCF47377.1    BDOT01000090    GCF50913.1    BDOT01000165    GCF53438.1    GCF47708.1    BDOT01000005    GCF41553.1    BDOT01000083    GCF50492.1    BDOT01000105    GCF51451.1    BDOT01000112    GCF51757.1    GCF40240.1    BDOT01000116    GCF51880.1    BDOT01000056    GCF48705.1    GCF40380.1    BDOT01000130    GCF52369.1    GCF44897.1    GCF48608.1    GCF40190.1    GCF40308.1    BDOT01000045    GCF47820.1    BDOT01000038    GCF47275.1    GCF48559.1    BDOT01000156    GCF53186.1    GCF40355.1    GCF45061.1    BDOT01000053    GCF48546.1    BDOT01000001    GCF39495.1    BDOT01000011    GCF43541.1    BDOT01000017    GCF44634.1    GCF41419.1    BDOT01000183    GCF53956.1    GCF39993.1    GCF53431.1    GCF47332.1    AHAT01022938    GCF40259.1    BDOT01000101    GCF51279.1    GCF41584.1    GCF41910.1    BDOT01000150    GCF53030.1    BDOT01000069    GCF49674.1    GCF44637.1    GCF48696.1    BDOT01000094    GCF51020.1    GCF48631.1    GCF41464.1    GCF41524.1    BDOT01000008    GCF42705.1    GCF47373.1    BDOT01000018    GCF44752.1    BDOT01000049    GCF48208.1    GCF53027.1    BDOT01000115    GCF51869.1    GCF48586.1    BDOT01000229    GCF55077.1    GCF40210.1    GCF51450.1    BDOT01000067    GCF49527.1    BDOT01000077    GCF50202.1    GCF44732.1    GCF51029.1    NCKU01003098    RWS08177.1    GCF46285.1    BDOT01000052    GCF48451.1    GCF48632.1    BDOT01000059    GCF48922.1    BDOT01000031    GCF46561.1    GCF49532.1    GCF50924.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03372   Exo_endo_phos
PF00168   C2
PF01388   ARID
PF02375   JmjN
PF02373   JmjC
PF02928   zf-C5HC2
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR016024   ARM-type_fold       
IPR017956   AT_hook_DNA-bd_motif       
IPR039776   Pds5       
IPR035892   C2_domain_sf       
IPR000008   C2_dom       
IPR030431   FAM189       
IPR003349   JmjN       
IPR001606   ARID_dom       
IPR004198   Znf_C5HC2       
IPR036431   ARID_dom_sf       
IPR003347   JmjC_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF48371   SSF48371       
SSF46774   SSF46774       
Gene 3D

Ontologies

Topology

Subcellular location
Nucleus  
Length:
320
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.80291
Exp number, first 60 AAs:
0.0490300000000001
Total prob of N-in:
0.11063
outside
1  -  320
 
 

Population Genetic Test Statistics

Pi
201.663839
Theta
112.73454
Tajima's D
2.75681
CLR
0.362364
CSRT
0.96395180240988
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号