Gene

KWMTBOMO09199  Validated by peptides from experiments

Pre Gene Modal

BGIBMGA003351

Annotation

minichromosome_maintenance_complex_component_7_[Bombyx_mori]

Location

Bomo_Chr15(-):13155064-13156953      View in EpiBrowser

Full name

DNA replication licensing factor MCM7       + More
DNA replication licensing factor Mcm7      
DNA replication licensing factor mcm7-B      
DNA replication licensing factor mcm7      
DNA replication licensing factor mcm7-A      

Alternative Name

Minichromosome maintenance 7 protein
CDC47 homolog B
CDC47-2p
Minichromosome maintenance protein 7-B
CDC47 homolog
Minichromosome maintenance protein 7
CDC47 homolog A
CDC47p
Minichromosome maintenance protein 7-A
p90

Location in the cell

Cytoplasmic   Reliability : 2.308 Nuclear   Reliability : 1.987

CDS

ATGCGTGATTACACTGCAGATAAAGAATCTTTCAAGAACTTTTTCGTTGATTTTTGTCAAACTGATGATGAAGGAAAAAAGTATTTTAAATATGCTGAACAACTTACTAAAGTTGCACACAGAGAACAGATAGCATTTGAAGTTGACTTGGATGATTTACATGAGATGAATGAAGATTTGACTGAGGCAGTCAAACAAAATACCAGAAGATACACTAATATGGTGTCAGACGTGGTTTATGAAATGCTGCCTGATTACAAATTCAAAGAGGTAGTAGCAAAGGATTCCTTGGATGTATACATTGAGCACAGAATTATGTTGGAAGCCAGAAACCACAGGATTCCTGGAGAAATGAGGGATCCTAGGAACAGATACCCACCAGAGCTCATCAGGAGATTTGAAGTGTACTTCAAAGACTTGTCAACATCGAAAAGTGTACCTATCAGAGAAGTTAAGGCTGAACATATTGGGAAACTAGTTACTGTGCGAGGTACATATTATAGTATAGTCATGTTGCATATACGAATATAG

Protein

MRDYTADKESFKNFFVDFCQTDDEGKKYFKYAEQLTKVAHREQIAFEVDLDDLHEMNEDLTEAVKQNTRRYTNMVSDVVYEMLPDYKFKEVVAKDSLDVYIEHRIMLEARNHRIPGEMRDPRNRYPPELIRRFEVYFKDLSTSKSVPIREVKAEHIGKLVTVRGTYYSIVMLHIRI

Description

Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Acts as component of the Mcm2-7 complex (Mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the Mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity.
Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. The existence of maternal and zygotic forms of mcm3 and mcm6 suggests that specific forms of mcm2-7 complexes may be used during different stages of development (By similarity).
Acts as component of the mcm2-7 complex (mcm complex) which is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. The active ATPase sites in the mcm2-7 ring are formed through the interaction surfaces of two neighboring subunits such that a critical structure of a conserved arginine finger motif is provided in trans relative to the ATP-binding site of the Walker A box of the adjacent subunit. The six ATPase active sites, however, are likely to contribute differentially to the complex helicase activity. The existence of maternal and zygotic forms of mcm3 and mcm6 suggests that specific forms of mcm2-7 complexes may be used during different stages of development.

Catalytic Activity

ATP + H2O = ADP + H(+) + phosphate

Subunit

Component of the Mcm2-7 complex. The complex forms a toroidal hexameric ring with the proposed subunit order Mcm2-Mcm6-Mcm4-Mcm7-Mcm3-Mcm5 (Probable).
Component of the mcm2-7 complex (RLF-M). The complex forms a toroidal hexameric ring with the proposed subunit order mcm2-mcm6-mcm4-mcm7-mcm3-mcm5. The heterodimer of mmcm3/mcm5 interacts with mcm4, mmcm6, mcm7 and weakly with mcm2. The N-terminus is required for interaction with mmcm3, though this interaction may not be direct, and remains in a complex with mmcm3 throughout the cell cycle. Begins to associate with zmcm6 at the neurula stage (By similarity). Component of the replisome complex (By similarity).
Component of the mcm2-7 complex (RLF-M). The complex forms a toroidal hexameric ring with the proposed subunit order mcm2-mcm6-mcm4-mcm7-mcm3-mcm5 (Probable). The heterodimer of mmcm3/mcm5 interacts with mcm4, mmcm6, mcm7 and weakly with mcm2. The N-terminus is required for interaction with mmcm3, though this interaction may not be direct, and remains in a complex with mmcm3 throughout the cell cycle. Begins to associate with zmcm6 at the neurula stage. Component of the replisome complex (By similarity).

Similarity

Belongs to the MCM family.

Keywords

ATP-binding   Cell cycle   Complete proteome   DNA replication   DNA-binding   Helicase   Hydrolase   Nucleotide-binding   Nucleus   Reference proteome   Metal-binding   Zinc   Zinc-finger  

Feature

chain  DNA replication licensing factor Mcm7

Uniprot

Q60GE6   H9J1G4   A0A437AXE5   A0A2H1V398   A0A2A4K5P9   A0A194PQX7   + More
A0A0L7KNN6   A0A194RP00   D6WK36   A0A2J7QTN3   A0A1B6CHG2   A0A090XB26   B4HK41   A0A131XVG5   A0A067R721   A0A131Z543   A0A1E1XG68   A0A2P8Y7I5   L7M6G7   A0A224YVW3   A0A1B6MDL9   A0A336MAI7   B4H9M2   A0A293N4B1   A0A1Z5KUK0   A0A1B6IDU9   B4QML9   B3NBM4   B4PFH7   Q9XYU0   B4KZG3   B7QHT6   A0A1W4VCI4   A0A0J9RS32   A0A3R7QWK7   A0A1B6GR93   Q29D32   E2AL70   A0A090XAY7   C3ZEX3   A0A3Q0ITS1   A0A3B0JBE8   B4LEP6   A0A1I8Q0B2   A0A0L0BMS2   A0A1J1IEB8   A0A0M4EGR2   A0A026WPZ1   N6TF82   W8BNL9   V5KXP1   B3M5X9   A0A0K8WEX4   A0A2P2I1N8   A0A151K3E9   A0A1L8H3C0   Q7ZXB1   B4MMD1   B4J3L8   A0A195FTX8   T1PBE8   W5KQY5   A0A1A9UP56   A0A0A1WYP5   A0A3B4B8T0   Q17ML5   A0A151X3K9   A0A1W2WB15   A0A151I2C1   A0A158NKZ4   A0A1B8Y939   Q6NX31   A0A0A9XGX9   F4WWT5   A0A1B0CLF2   E2BME7   A0A1Y1KVC9   A0A0J7KE46   A0A3B3RCA0   A0A1B0FC91   A0A0P4VTB0   A0A3Q0R3X1   A0A0C9QWH7   A0A1A9ZBZ2   A0A146XPY6   A0A423TWM4   A0A182GAT2   A0A1A9XQV9   A0A1B0ANR5   A0A1A9W3H0   B0VZP1   A0A084WDI5   Q91876   A0A087UTA1   A0A3B5KJS6   A0A2D0PT24   A0A3Q1BNY5   A0A3B4Z553   A0A2L2Y8F0  

EC Number

3.6.4.12

Pubmed

19121390    26354079    26227816    18362917    19820115    25970599    + More
17994087    24845553    26830274    28503490    29403074    25576852    28797301    28528879    17550304    9795205    10023044    10731132    12537572    16798881    20122406    22936249    15632085    20798317    18563158    26108605    24508170    30249741    23537049    24495485    27762356    9214647    25315136    25329095    25830018    25463417    17510324    21347285    20431018    25401762    26823975    21719571    28004739    29240929    27129103    26483478    24438588    8816774    9214646    9512418    9851868    16369567    21551351    26561354   

EMBL

AB177622    BAD61056.1    BABH01023773    BABH01023774    BABH01023775    RSAL01000296    + More
RVE42822.1    ODYU01000468    SOQ35313.1    NWSH01000144    PCG79103.1    KQ459602    KPI93535.1    JTDY01007844    KOB64907.1    KQ460106    KPJ17746.1    KQ971342    EFA03620.1    NEVH01011194    PNF31951.1    GEDC01024392    JAS12906.1    GBIH01000593    JAC94117.1    CH480815    EDW40777.1    GEFM01004512    JAP71284.1    KK852901    KDR14096.1    GEDV01002991    JAP85566.1    GFAC01001097    JAT98091.1    PYGN01000833    PSN40226.1    GACK01005138    JAA59896.1    GFPF01007297    MAA18443.1    GEBQ01005944    JAT34033.1    UFQS01000305    UFQT01000305    SSX02684.1    SSX23058.1    CH479229    EDW36498.1    GFWV01022869    MAA47596.1    GFJQ02008203    JAV98766.1    GECU01022588    JAS85118.1    CM000363    EDX09773.1    CH954178    EDV50620.1    CM000159    EDW93103.1    AB010109    AF124743    AE014296    BT001526    CH933809    EDW17890.1    ABJB010049488    ABJB010084779    ABJB010367990    ABJB010443466    ABJB010659432    ABJB010997321    DS941638    EEC18408.1    CM002912    KMY98492.1    QCYY01001058    ROT80844.1    GECZ01004813    JAS64956.1    CH379070    EAL30582.1    GL440492    EFN65825.1    GBIH01000594    JAC94116.1    GG666612    EEN49279.1    OUUW01000002    SPP77352.1    CH940647    EDW69131.1    JRES01001641    KNC21307.1    CVRI01000047    CRK98114.1    CP012525    ALC43652.1    KK107152    QOIP01000007    EZA57154.1    RLU20693.1    APGK01006422    APGK01006423    APGK01040416    APGK01040417    KB740979    KB736759    ENN76428.1    ENN83143.1    GAMC01011579    JAB94976.1    KF471134    AHA42534.1    CH902618    EDV39669.1    GDHF01002715    JAI49599.1    IACF01002298    LAB67957.1    LKEY01042441    KYN50597.1    CM004470    OCT90585.1    U66710    BC045072    AAC60228.1    AAH45072.1    CH963847    EDW73276.1    CH916366    EDV96220.1    KQ981281    KYN43344.1    KA645984    AFP60613.1    GBXI01010103    JAD04189.1    CH477205    EAT47909.1    KQ982557    KYQ55026.1    KQ976546    KYM80958.1    ADTU01019058    KV460378    OCA19456.1    CR855766    BC067307    AAH67307.1    GBHO01025556    GDHC01009877    JAG18048.1    JAQ08752.1    GL888413    EGI61323.1    AJWK01017185    GL449192    EFN83138.1    GEZM01074886    JAV64421.1    LBMM01008881    KMQ88562.1    CCAG010011826    GDKW01000753    JAI55842.1    GBYB01000075    JAG69842.1    GCES01042175    JAR44148.1    ROT80847.1    JXUM01001904    KQ560130    KXJ84283.1    JXJN01000936    DS231815    EDS35133.1    ATLV01023022    KE525339    KFB48279.1    U51234    U44051    BC072932    KK121487    KFM80590.1    IAAA01009830    IAAA01009831    LAA04441.1   

Proteomes

UP000005204    UP000283053    UP000218220    UP000053268    UP000037510    UP000053240    + More
UP000007266    UP000235965    UP000001292    UP000027135    UP000245037    UP000008744    UP000000304    UP000008711    UP000002282    UP000000803    UP000009192    UP000001555    UP000192221    UP000283509    UP000001819    UP000000311    UP000001554    UP000079169    UP000268350    UP000008792    UP000095300    UP000037069    UP000183832    UP000092553    UP000053097    UP000279307    UP000019118    UP000007801    UP000078492    UP000186698    UP000007798    UP000001070    UP000078541    UP000095301    UP000018467    UP000078200    UP000261520    UP000008820    UP000075809    UP000078540    UP000005205    UP000008143    UP000007755    UP000092461    UP000008237    UP000036403    UP000261540    UP000092444    UP000261340    UP000092445    UP000069940    UP000249989    UP000092443    UP000092460    UP000091820    UP000002320    UP000030765    UP000054359    UP000005226    UP000221080    UP000257160    UP000261400   

PRIDE

Q60GE6    H9J1G4    Q9XYU0    Q6NX31    Q91876   

Pfam

PF17207   MCM_OB        + More
PF00493   MCM
PF17855   MCM_lid
PF14551   MCM_N

Interpro

IPR041562   MCM_lid        + More
IPR027417   P-loop_NTPase       
IPR003593   AAA+_ATPase       
IPR031327   MCM       
IPR001208   MCM_dom       
IPR008050   MCM7       
IPR012340   NA-bd_OB-fold       
IPR018525   MCM_CS       
IPR027925   MCM_N       
IPR033762   MCM_OB       

SUPFAM

SSF52540   SSF52540        + More
SSF50249   SSF50249       

ProteinModelPortal

Q60GE6   H9J1G4   A0A437AXE5   A0A2H1V398   A0A2A4K5P9   A0A194PQX7   + More
A0A0L7KNN6   A0A194RP00   D6WK36   A0A2J7QTN3   A0A1B6CHG2   A0A090XB26   B4HK41   A0A131XVG5   A0A067R721   A0A131Z543   A0A1E1XG68   A0A2P8Y7I5   L7M6G7   A0A224YVW3   A0A1B6MDL9   A0A336MAI7   B4H9M2   A0A293N4B1   A0A1Z5KUK0   A0A1B6IDU9   B4QML9   B3NBM4   B4PFH7   Q9XYU0   B4KZG3   B7QHT6   A0A1W4VCI4   A0A0J9RS32   A0A3R7QWK7   A0A1B6GR93   Q29D32   E2AL70   A0A090XAY7   C3ZEX3   A0A3Q0ITS1   A0A3B0JBE8   B4LEP6   A0A1I8Q0B2   A0A0L0BMS2   A0A1J1IEB8   A0A0M4EGR2   A0A026WPZ1   N6TF82   W8BNL9   V5KXP1   B3M5X9   A0A0K8WEX4   A0A2P2I1N8   A0A151K3E9   A0A1L8H3C0   Q7ZXB1   B4MMD1   B4J3L8   A0A195FTX8   T1PBE8   W5KQY5   A0A1A9UP56   A0A0A1WYP5   A0A3B4B8T0   Q17ML5   A0A151X3K9   A0A1W2WB15   A0A151I2C1   A0A158NKZ4   A0A1B8Y939   Q6NX31   A0A0A9XGX9   F4WWT5   A0A1B0CLF2   E2BME7   A0A1Y1KVC9   A0A0J7KE46   A0A3B3RCA0   A0A1B0FC91   A0A0P4VTB0   A0A3Q0R3X1   A0A0C9QWH7   A0A1A9ZBZ2   A0A146XPY6   A0A423TWM4   A0A182GAT2   A0A1A9XQV9   A0A1B0ANR5   A0A1A9W3H0   B0VZP1   A0A084WDI5   Q91876   A0A087UTA1   A0A3B5KJS6   A0A2D0PT24   A0A3Q1BNY5   A0A3B4Z553   A0A2L2Y8F0  

PDB

6HV9     E-value=4.38903e-10,     Score=150

KEGG

692463    K02210 DNA replication licensing factor MCM7 [EC:3.6.4.12] | (RefSeq) Mcm7; minichromosome maintenan

PATHWAY

03030    DNA replication - Bombyx mori (domestic silkworm)

GO

GO:0007049   GO:0003677   GO:0042555   GO:0005524   GO:0003678   GO:0005634   GO:0006270   GO:0003697   GO:0006267   GO:0006268   GO:0006271   GO:0000727   GO:0003688   GO:0043138   GO:0006260   GO:0004386   GO:0046872   GO:0030174   GO:0000785  

PANTHER

PTHR11630:SF26   PTHR11630  

Subcellular location

Nucleus  

Length:

176

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.03568

Exp number, first 60 AAs:

0

Total prob of N-in:

0.42874

outside

1  -  176

 

 

Pi

247.768273

Theta

202.194401

Tajima's D

0.831629

CLR

0

CSRT

0.615269236538173

Interpretation

Uncertain