SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09112
Annotation
PREDICTED:_uncharacterized_protein_LOC106110673_[Papilio_polytes]
Location in the cell
Nuclear   Reliability : 3.324
 

Sequence

CDS
ATGGATGAGAAATTAAAACCTATTTTAGAGGAAAATAAATACTTAAAATTAAAAGTAGAGAACTTGGAAAAGAAAATCGAAATTTTAGAGAGAGATAAGAAAACTAACAATATAATAATCCATGGATTGACAGAAGACGAGAAATCGACACCCGAGCTTATCGACAAGGTCAAAGATACAATAACAAAAGAATTAGGCATAGCAATCGAAAATTATGAATTCAACAAAATATATCGTATTGGTAAAACAAACAAAGGTAATCCATCAAAGGTAATCCGACCTATACTAATATGCTTGACTACTGGATGGAAAAAAGCGGAAATATTGAAAAATAAGAGAAAGTTAAAAGACCTGCATATCACGGAAGATTACTCTAAAGAAACCTTAGAAAAACGTAAGGCTTTACTACCACAACTCATGGAAGAACGGAGAAAAGGTAATTTCGCCTATTTAAGATATGATAAACTAATAATTAAAGAAAATAAATACGTCAAGGACTCGAGGAAGAGAGAACTCTCAATTTCACCACAAACAAACTCTCAATCCAAAAAAATTCAACCTTCAACTTCAGCCAAGAATAACAGAACGAATGCATTCGATTTGATGAGAGGTCGGTCTAACTCTTTCACAACATTGACGACAGGTCAAAAACAATAG
Protein
MDEKLKPILEENKYLKLKVENLEKKIEILERDKKTNNIIIHGLTEDEKSTPELIDKVKDTITKELGIAIENYEFNKIYRIGKTNKGNPSKVIRPILICLTTGWKKAEILKNKRKLKDLHITEDYSKETLEKRKALLPQLMEERRKGNFAYLRYDKLIIKENKYVKDSRKRELSISPQTNSQSKKIQPSTSAKNNRTNAFDLMRGRSNSFTTLTTGQKQ

Summary

EMBL
NWSH01001196    PCG72157.1    NWSH01004020    PCG65566.1    NWSH01003397    PCG66369.1    + More
JTDY01003098    KOB70157.1    NWSH01005231    PCG64345.1    NWSH01000260    PCG77926.1    JTDY01000539    KOB76734.1    JTDY01002536    KOB71226.1    JTDY01000743    KOB76037.1    JTDY01000511    KOB76839.1    BABH01024878    NWSH01003169    PCG66835.1    JTDY01007450    KOB65190.1    KZ150150    PZC72845.1    JTDY01001041    KOB75043.1    JTDY01008572    KOB64508.1    NWSH01002532    PCG68054.1    ODYU01000585    SOQ35630.1    ODYU01013311    SOQ60019.1    ODYU01000586    SOQ35631.1    JTDY01001071    KOB74965.1    JTDY01000484    KOB76970.1    JTDY01001949    KOB72466.1    FJ265564    ADI61832.1    ODYU01001637    SOQ38140.1    NWSH01001771    PCG70189.1    GDQN01002055    GDQN01002009    JAT88999.1    JAT89045.1    BABH01021795    GBGD01002698    JAC86191.1    JTDY01001738    KOB73038.1    JTDY01007191    KOB65392.1    JTDY01009161    KOB64038.1    NWSH01000023    PCG80652.1    GBBI01000452    JAC18260.1    ODYU01008249    SOQ51673.1    KQ459995    KPJ18566.1    JTDY01014369    KOB52037.1    JTDY01016948    KOB51874.1    NWSH01002039    PCG69337.1    JTDY01000843    KOB75692.1    NWSH01001568    PCG70835.1    GBGD01002692    JAC86197.1    JTDY01000408    KOB77334.1    JTDY01000076    KOB79001.1    FJ265563    ADI61831.1    JTDY01010650    KOB58126.1    GEZM01094174    GEZM01094173    JAV55842.1    ACPB03011704    ACPB03011705    ACPB03011706    ACPB03011707    ACPB03011708    ACPB03011709    ACPB03011710    ACPB03011711    ACPB03011712    ACPB03011713    GBGD01002635    JAC86254.1    FJ265562    ADI61830.1    JTDY01002685    KOB70933.1    JTDY01002701    KOB70892.1    JTDY01000780    JTDY01000104    JTDY01000008    KOB75906.1    KOB78842.1    KOB79479.1    JTDY01009971    KOB62006.1    GEZM01063671    JAV69026.1    GEZM01039814    JAV81166.1    JTDY01000437    KOB77173.1    JTDY01001015    KOB75121.1    JTDY01000100    KOB78869.1    JTDY01000640    KOB76373.1    JTDY01008567    KOB64512.1    GEGO01006805    JAR88599.1    GEZM01082533    JAV61335.1    GBIH01002636    JAC92074.1    ODYU01010663    SOQ55918.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF00501   AMP-binding
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR027124   Swc5/CFDP2       
IPR000477   RT_dom       
IPR004244   Transposase_22       
IPR020845   AMP-binding_CS       
IPR042099   AMP-dep_Synthh-like_sf       
IPR000873   AMP-dep_Synth/Lig       
IPR001680   WD40_repeat       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR011990   TPR-like_helical_dom_sf       
IPR036322   WD40_repeat_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF50978   SSF50978       

Ontologies

Topology

Length:
218
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00123
Exp number, first 60 AAs:
0
Total prob of N-in:
0.03521
outside
1  -  218
 
 

Population Genetic Test Statistics

Pi
227.011546
Theta
129.386782
Tajima's D
2.162949
CLR
2.474032
CSRT
0.906954652267387
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号