SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO09048
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.375 Nuclear   Reliability : 1.99
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGCTATGCGGATGACAGCACGGGTGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGCGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATTGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCTCTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCTGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCAGTAGGCAGCGGCTTGGCTCTGCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAACCACTCACCATCAGGTGGGCCGTATGCTCGTCTGCCTACAAGGGCAATAAAAAAAAAAAAAAAAAAAAAAAAAACAATTCAACATATTTATAAGATGCTAAAATAG
Protein
MTINAGVPQGSVLSPTLFILYINDMLSIDGMHCYADDSTGDARYIGHQSLSRSAVQERRSKLVSEVENSLGRVSEWGELNLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQRRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSSRQRLGSALALLKSMGDGNHSPSGGPYARLPTRAIKKKKKKKKTIQHIYKMLK

Summary

EMBL
AY359886    AAQ57129.1    RSAL01000109    RVE47192.1    RSAL01002067    RVE40593.1    + More
RSAL01000487    RVE41561.1    RSAL01000422    RVE41792.1    RSAL01000072    RVE49051.1    RSAL01000002    RVE54942.1    RSAL01000210    RVE44225.1    RSAL01003136    RVE40332.1    RSAL01002827    RVE40408.1    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    RSAL01000007    RVE54134.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    RSAL01000193    RVE44603.1    GFAC01000919    JAT98269.1    GEFM01002394    JAP73402.1    GEGO01001118    JAR94286.1    GEFM01002324    JAP73472.1    GFAA01002514    JAU00921.1    GEFM01006417    JAP69379.1    GBIH01002577    JAC92133.1    GFAA01002657    JAU00778.1    GFAC01005646    JAT93542.1    GFAA01002479    JAU00956.1    GEGO01004433    JAR90971.1    GEGO01004630    JAR90774.1    GEGO01003312    JAR92092.1    GDRN01111277    JAI56804.1    GEFM01002419    JAP73377.1    GEFM01006421    JAP69375.1    GFAC01005665    JAT93523.1    GEGO01002473    JAR92931.1    GEFM01005882    JAP69914.1    MRZV01000639    PIK46517.1    FLMD02000154    SCV66010.1    GDRN01111334    JAI56796.1    LSMT01000297    PFX20951.1    GEGO01003111    JAR92293.1    GEGO01004295    JAR91109.1    NSIT01000218    PJE78268.1    NSIT01000412    PJE77717.1    FLMD02000280    SCV66640.1    GEGO01003518    JAR91886.1    GEGO01007187    JAR88217.1    GFAA01002385    JAU01050.1    NSIT01000271    PJE78081.1    NSIT01000239    PJE78188.1    GEGO01003794    JAR91610.1    GFAC01000861    JAT98327.1    GADI01001229    JAA72579.1    GFAA01000066    JAU03369.1    KZ505886    PKU43598.1    GFAA01003161    JAU00274.1    GFAC01005670    JAT93518.1    GEGO01007438    JAR87966.1    LSMT01000588    PFX15986.1    AAGJ04095885    NSIT01000164    PJE78524.1    GEGO01004056    JAR91348.1    GEGO01002794    JAR92610.1    PSZC01000087    PPJ25136.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF00458   WHEP-TRS
PF03372   Exo_endo_phos
PF01425   Amidase
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR028082   Peripla_BP_I       
IPR036291   NAD(P)-bd_dom_sf       
IPR002347   SDR_fam       
IPR020904   Sc_DH/Rdtase_CS       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR000120   Amidase       
IPR036928   AS_sf       
IPR023631   Amidase_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF53822   SSF53822       
SSF51735   SSF51735       
SSF47060   SSF47060       
SSF75304   SSF75304       
Gene 3D

Ontologies

Topology

Length:
364
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.702699999999999
Exp number, first 60 AAs:
0.70242
Total prob of N-in:
0.04347
outside
1  -  364
 
 

Population Genetic Test Statistics

Pi
35.113878
Theta
39.462428
Tajima's D
-0.96403
CLR
0
CSRT
0.141192940352982
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号