SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08982
Annotation
PREDICTED:_uncharacterized_protein_LOC105842017_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 3.832
 

Sequence

CDS
ATGTCGCTACCCGAAAGTGGAAATACTCCAACATCAGAAGAGGGAACACCACGTGACGAACAACGGCCTAATGACGTAATCCAAGCTATGGCAGACGCATTTAAAACCACGATGAACGATATGATGACTCAACTGTCTTACGATCATCGCGTAACCTTGACTGAAATGATCAGCTCCATGAAATCAGAAGAAAATACGCGAGTGCGCATTGCCGACATTTATTTTCCTACATATGACCCCGATTCTAGTACCGATGTACACGATTGGGTAGATCTTATTACACGTACTCAAGCAGAATATGGACTTCGAGATCATGAGGTACGATTAAAAGCAGCAAGTGTATTAAAAGGTCGTGCAAAGACATGGGCAGATAGTAGCCTCCTAAGGACAACAACCTGGACGGAAATGCGGGATGACATGTTGCAAACTTTCGAACCCGAATCCAGGTACTTTGCAGATATTCTGAGTTATAGAAATTACACCATTGACAAGGCAGAAAACATTCAAGATTTTATTTCAAACGTGTGGCGTATGTTCAAAAGGATAGTAAAATCTAATCCAACGGAACAGGATGCAGTAGAATTTGTCATTGGGAGCATTGGAGATGAACGGATTCGGACAGAACTGCTCAATAGCAAGTCAAATACTGTTCCGGAGTTAATTGCTATAGCCAAAACGTTTCGCAAACGAAAGAATATACCAACTCAACCGACTGAGTTCAGTAAGCAACCTCGTTTGAACTTCAATCGTGATAGATCCAACTTGACTTGTCATGTTTGTGGAAAAACAGGTCATTTTGCTGGATATTGCCCGGAAAATGCAATTCGACGTGGAACGTTTTCAGCATCAGGATCAGGAGCTTCTTTCTCATCAAGAGATTCGCCTGCACCATCCATTAAGGAGTGTTCCTACTGTAAAGGGACTCGACACACTACAGAAAGATGTTTTAAAAGAATTGCTGACGAACAACACAGTAAAACAGTGAATCTATGA
Protein
MSLPESGNTPTSEEGTPRDEQRPNDVIQAMADAFKTTMNDMMTQLSYDHRVTLTEMISSMKSEENTRVRIADIYFPTYDPDSSTDVHDWVDLITRTQAEYGLRDHEVRLKAASVLKGRAKTWADSSLLRTTTWTEMRDDMLQTFEPESRYFADILSYRNYTIDKAENIQDFISNVWRMFKRIVKSNPTEQDAVEFVIGSIGDERIRTELLNSKSNTVPELIAIAKTFRKRKNIPTQPTEFSKQPRLNFNRDRSNLTCHVCGKTGHFAGYCPENAIRRGTFSASGSGASFSSRDSPAPSIKECSYCKGTRHTTERCFKRIADEQHSKTVNL

Summary

EMBL
NWSH01001784    PCG70139.1    BABH01005776    BABH01005777    BABH01005778    BABH01005779    + More
ODYU01010650    SOQ55901.1    GALX01004016    JAB64450.1    ODYU01008498    SOQ52151.1    ODYU01007591    SOQ50498.1    JTDY01001444    KOB73848.1    GDQN01006390    JAT84664.1    GDQN01004694    GDQN01000397    JAT86360.1    JAT90657.1    EF710649    ACE75273.1    X14037    CAA32198.1    ODYU01010203    SOQ55164.1    GEZM01075334    JAV64136.1    GBHO01040011    JAG03593.1    ODYU01003642    SOQ42653.1    ODYU01013294    SOQ60001.1    AGBW02008828    OWR52464.1    GDQN01002470    JAT88584.1    GBHO01032416    JAG11188.1    GEZM01045832    JAV77665.1    BABH01029403    BABH01029404    BABH01029405    BABH01029406    GDHC01020530    JAP98098.1    KQ971375    EEZ97626.2    GEZM01033082    GEZM01033081    GEZM01033080    JAV84428.1    NWSH01001094    PCG72656.1    NWSH01000145    PCG79083.1    JXUM01273089    KQ652564    KXJ62316.1    GALX01002105    JAB66361.1    GBHO01013472    GBHO01013470    JAG30132.1    JAG30134.1    KQ971345    EFA05053.1    GDHC01015012    JAQ03617.1    KZ149907    PZC78253.1    GBHO01032415    JAG11189.1    GBHO01030786    JAG12818.1    GEZM01007616    GEZM01007615    GEZM01007614    GEZM01007613    GEZM01007612    GEZM01007611    JAV95055.1    NWSH01002289    PCG68667.1    CH902641    KPU74713.1    ANIX01003619    ETP05092.1    LBMM01011887    KMQ86572.1    GDHC01004980    JAQ13649.1    GBHO01032414    JAG11190.1    NWSH01007700    PCG62845.1   
Pfam
PF03732   Retrotrans_gag        + More
PF14844   PH_BEACH
PF00077   RVP
PF00078   RVT_1
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF00665   rve
PF00098   zf-CCHC
PF17917   RT_RNaseH
PF02037   SAP
Interpro
IPR005162   Retrotrans_gag_dom        + More
IPR036875   Znf_CCHC_sf       
IPR023362   PH-BEACH_dom       
IPR016024   ARM-type_fold       
IPR013320   ConA-like_dom_sf       
IPR021109   Peptidase_aspartic_dom_sf       
IPR000477   RT_dom       
IPR018061   Retropepsins       
IPR001878   Znf_CCHC       
IPR001969   Aspartic_peptidase_AS       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR012337   RNaseH-like_sf       
IPR001995   Peptidase_A2_cat       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR041373   RT_RNaseH       
IPR003034   SAP_dom       
IPR036361   SAP_dom_sf       
IPR032567   LDOC1-rel       
SUPFAM
SSF57756   SSF57756        + More
SSF49899   SSF49899       
SSF48371   SSF48371       
SSF50630   SSF50630       
SSF53098   SSF53098       
SSF68906   SSF68906       
Gene 3D

Ontologies

Topology

Length:
330
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00424
outside
1  -  330
 
 

Population Genetic Test Statistics

Pi
472.79466
Theta
250.423345
Tajima's D
2.797287
CLR
0
CSRT
0.969351532423379
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号