SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08967
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.355 Nuclear   Reliability : 1.558
 

Sequence

CDS
ATGGGCGTTCCCATGCATCTGATTCAGCTGATGAGAGCCCTGTACCTGTCGGGACGGGGATCGGTACGGATCGGCCCAGCACAATCAAGAGAGTTCCGATTTGAGAAAGGAGTGCGCCAGGGTTGCATCGTGTCGCCCATACTTTTTAACATCTATGGCGAATACATAATGCGCAAAACCCTAGAGGAGTGGGATGGTGGCGTCACAGTTGGGGGCGTAAAGATCTCGAACTTACGATACGCTGATGATACCACATTAGTGGCGTCATCAGAAGAGGAAATGGAGGAGCTGCTGCGACGTCTGGTTATAGTTAGCGAGGAAATGGGACTAAAGATCAACCAGTCCAAAACAAAGATCATGATCGTGGATAAATACGGCACCCTTAACGAAAATAATATTCTTGGGCAATACGACATCGTCAAGACTTTCGTGTACCTCGGCTCGATTATTTCCAATAGAGGTGGATCGGAAACCGAAATAAGGCGACGCATCGGAATGGCCAAATCCGCTATGAGCCAGCTAAACAAAATATGGAGAGATCGAAACATACTCAAGAAAACGAAAGTGCAAATTGTTGAGACGCTCGTTTTCTTAATCTTTTTGTATGGGGCTGAGACCTGGATCTTGAAAGAGTCTGACAGGCGACGCATAGACGCGTTTGAGATGTGGTGCTGGCGGCGCATGTTGCGCATCCCTTGGACGGCTTTCCGGACGAACGCTTCCATCCTCAACGAGCTAAAAGTTGACCAGAGGCTATCCACCAAATGTCTATATAGAGTGCTCCAATACTTTGGTCATATAGCAAGAAAACCCTCTGACAACCTGGAGAGACTCATAGTGACGGGTAAAGTGGATGGAAGACGATCCAGAGGTCGTAGCCGAAAAAGATGGAGTGACCAAGTGTCTGAGTGTCTGGACATGAGACTAAGCCACGCACTTCACTGTGCCACAGACCGACATAAGTGGCTACAAATTACAAAAAAAGGTCACAGGCGGGCGCATCACGATGCTCAGCAATGA
Protein
MGVPMHLIQLMRALYLSGRGSVRIGPAQSREFRFEKGVRQGCIVSPILFNIYGEYIMRKTLEEWDGGVTVGGVKISNLRYADDTTLVASSEEEMEELLRRLVIVSEEMGLKINQSKTKIMIVDKYGTLNENNILGQYDIVKTFVYLGSIISNRGGSETEIRRRIGMAKSAMSQLNKIWRDRNILKKTKVQIVETLVFLIFLYGAETWILKESDRRRIDAFEMWCWRRMLRIPWTAFRTNASILNELKVDQRLSTKCLYRVLQYFGHIARKPSDNLERLIVTGKVDGRRSRGRSRKRWSDQVSECLDMRLSHALHCATDRHKWLQITKKGHRRAHHDAQQ

Summary

EMBL
FJ265557    ADI61825.1    FJ265548    ADI61816.1    FJ265546    ADI61814.1    + More
FJ265553    ADI61821.1    KZ150203    PZC72267.1    FJ265547    ADI61815.1    FJ265552    ADI61820.1    RSAL01000289    RVE42931.1    FJ265560    ADI61828.1    GU815090    ADF18553.1    BDOT01000002    GCF39995.1    BDOT01000039    GCF47371.1    BDOT01000104    GCF51438.1    BDOT01000043    GCF47717.1    BDOT01000015    BDOT01000055    BDOT01000148    GCF44364.1    GCF48654.1    GCF52988.1    BDOT01000089    GCF50820.1    BDOT01000474    GCF58974.1    GCF40240.1    BDOT01000143    GCF52806.1    BDOT01000062    GCF49174.1    BDOT01000054    GCF48637.1    BDOT01000105    GCF51451.1    GCF40256.1    BDOT01000116    GCF51880.1    BDOT01000006    GCF41961.1    GCF48602.1    BDOT01000028    GCF46132.1    BDOT01000112    GCF51757.1    BDOT01000020    GCF44935.1    BDOT01000090    GCF50913.1    GCF40190.1    MRZV01002322    PIK33998.1    BDOT01000149    GCF53002.1    BDOT01000029    GCF46280.1    GCF47356.1    BDOT01000130    GCF52369.1    BDOT01000022    GCF45060.1    GCF40380.1    GCF48608.1    GCF47377.1    BDOT01000048    GCF48010.1    BDOT01000011    GCF43541.1    BDOT01000083    GCF50492.1    BDOT01000056    GCF48705.1    BDOT01000156    GCF53186.1    GCF40308.1    GCF48559.1    BDOT01000005    GCF41553.1    AHAT01022938    BDOT01000045    GCF47820.1    GCF47708.1    BDSA01000081    GBE63537.1    BDOT01000001    GCF39495.1    GCF44897.1    GCF45061.1    GCF41419.1    BDOT01000017    GCF44637.1    BDOT01000094    GCF51029.1    GCF40355.1    GCF39993.1    GCF51020.1    BDOT01000183    GCF53956.1    GCF48586.1    GCF40259.1    BDOT01000150    GCF53030.1    GCF41910.1    GCF41584.1    BDOT01000165    GCF53431.1    BDOT01000049    GCF48208.1    ODYU01004401    SOQ44236.1    GCF41464.1    GCF48696.1    GCF48631.1    GCF47373.1    BDOT01000018    GCF44752.1    GCF51450.1    BDOT01000069    GCF49674.1    GCF41524.1    GCF44634.1    BDOT01000038    GCF47332.1    BDOT01000077    GCF50202.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03372   Exo_endo_phos
PF00168   C2
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002138   Pept_C14_p10       
IPR030431   FAM189       
IPR035892   C2_domain_sf       
IPR000008   C2_dom       
IPR016024   ARM-type_fold       
IPR017956   AT_hook_DNA-bd_motif       
IPR039776   Pds5       
SUPFAM
SSF56219   SSF56219        + More
SSF48371   SSF48371       
Gene 3D

Ontologies

Topology

Length:
339
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
3.70768
Exp number, first 60 AAs:
0.04073
Total prob of N-in:
0.05035
outside
1  -  339
 
 

Population Genetic Test Statistics

Pi
25.176171
Theta
15.488208
Tajima's D
-1.259192
CLR
1166.554903
CSRT
0.0928953552322384
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号