SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08950
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.372 Mitochondrial   Reliability : 1.441
 

Sequence

CDS
ATGCTGGGAGTCCTCAACAGAGCGAAGCGGTGCTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGAGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTAGAGCCTGTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGCGTTTTGTACCAAGAGAGCTACAACAAACAAAATGATCAGGTGTACGCACACAGTAGTGAAAAAGCGACCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATATAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATACCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCTACACTTGGAGGAAAAGACGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGGCATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MLGVLNRAKRCFTPGQRLLLYKAQVRPRVEYCSHLWAEAPKYQLLPFDSIQRRAVRIVDNPILTDRLEPVGLRRDFGSLCVLYQESYNKQNDQVYAHSSEKATNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNIVLTNLVEPVSHTMFNNRHWVFQQDSAPAHRAKSEIDFIRHEDWPSSSPDLNPLDYKIWLHLEEKTCSKPHPNLESLKTSLIKAAADIGMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB473770    BAH20555.1    AB363018    BAG15926.1    RSAL01000084    RVE48403.1    RSAL01000012    RVE53510.1    RSAL01000021    RVE52408.1    RSAL01000191    RVE44681.1    U47917    AAB47739.1    RSAL01000063    RVE49524.1    RSAL01000140    RVE46091.1    LNIX01000030    OXA41211.1    JARK01001411    EYC06502.1    JOJR01000015    RCN51257.1    JOJR01000583    RCN36166.1    DS268747    EFP00909.1    CAVP010059404    CDL95787.1    UYSL01019905    VDL71189.1    PDUG01000012    PIC13506.1    DS268565    EFO90304.1    DS268492    EFP11674.1    DS268539    EFO88027.1    EFP11689.1    DS268428    EFO94379.1    DS268508    EFO83264.1    DS268606    EFO93488.1    DS268466    EFP06959.1    DS268679    EFO98285.1    HE601413    CAS00486.1    DS268525    EFO85497.1    JARK01000059    EYC44525.1    JARK01001418    EYC05389.1    PDUG01000005    PIC23776.1    DS268421    EFO88618.1    DS268673    EFO98001.1    JARK01001345    EYC27589.1    PIC28734.1    DS268545    EFO88382.1    JARK01000255    EYC39473.1    UZAH01036445    VDP45493.1    DS268612    EFO94085.1    JARK01000176    EYC41234.1    UZAH01001595    VDO19836.1    JARK01001601    EYB87313.1    UZAH01029309    VDP05368.1    PDUG01000006    PIC20538.1    UZAH01027002    VDO87649.1    JARK01001337    EYC34439.1    PIC29926.1    PDUG01000001    PIC51673.1    UZAH01027257    VDO90094.1    JARK01001658    EYB84158.1   
Pfam
PF00019   TGF_beta        + More
PF16095   COR
PF00069   Pkinase
PF13358   DDE_3
PF00292   PAX
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR038717   Tc1-like_DDE_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR001523   Paired_dom       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
Gene 3D
PDB
5CR4     E-value=4.70291e-09,     Score=144

Ontologies

Topology

Subcellular location
Secreted  
Length:
264
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.2766
Exp number, first 60 AAs:
0
Total prob of N-in:
0.07229
outside
1  -  264
 
 

Population Genetic Test Statistics

Pi
12.614819
Theta
16.766181
Tajima's D
-0.747859
CLR
0
CSRT
0.190090495475226
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号