SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08938
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.128 Nuclear   Reliability : 1.733
 

Sequence

CDS
ATGCTAGTCAGCAAACCCAGGAGCAAAGAAAGCTATTTAAGCAAGGAGACACTAGAACTATTGGATAAAAGAAGAACACTAATATCAAATAAAGGGGATAAAGAAAGACGCCAAAAAATTGCAAACCTTAGCAAGAAAATTAAGGAGAATATAAGAAAAGACCGTAGAGAGAAAAGAAATAGTGTTTTAGAAGAAAATATAAAAAGAACAGGAGGAACAAAAAAGGCTCTGAAGCAACTAAGCGAACATGGGAAAGAATGGATATTGAAACTGAACCAACGCGAATCTAACTTAATTAACCGACTCTCAATACTGAAACTAGCCACGGACTATTACCGCCTATTGTATTCTGATAAATTAGGTTCAGGGTTGGACACAATTCCGGAAGTTTACGAACCAAATGAAAACAAAGTAGACGAAGTGCCAGAGATCCTTGCCTCAGAGGTAACCAAGGCAATAAAATCCCAAAAACTCGAGAAAGCTCCAGGGCCGGACAAGATACCTAACGAAATGCTTAAGGGAACTTTAGAGGAAATCAGTCCTGTGCTGGCAAAACTCTTCAATGAAATCCTACAAACAAGGCAAATCCCAGAAGAATGGACCGAGTGCCACATAATTTTACTACATAAAAAAGGCACTAGAGACGAGATTGGGAACTATAGGCCAATTTCTCTAATATCAAACATATATAAAGTATTTGCTAAAGTGATCCTGGAAAGAATATCATTAACGCTAAATGAAAGCCAACCCGCAGAGCAGGCAGGATTCAGAAAAGGCTTCAGCACAATAGATCATATTCACACAATAAAACAGTTGATACAGAAGTATAATGAATACAATAAACAAATATACTTGGCGTTCATAGATTACTCAAAGGCATTCGATAGCCTCAGGCACCAATACATATGGCGGAGTCTTGAACAACAAGGAGTCCAGAGCAACTATATAGAAATACTCAAGAGTATATATAAATCTAGCAAGGCCAGTATCAAACTTGAATAA
Protein
MLVSKPRSKESYLSKETLELLDKRRTLISNKGDKERRQKIANLSKKIKENIRKDRREKRNSVLEENIKRTGGTKKALKQLSEHGKEWILKLNQRESNLINRLSILKLATDYYRLLYSDKLGSGLDTIPEVYEPNENKVDEVPEILASEVTKAIKSQKLEKAPGPDKIPNEMLKGTLEEISPVLAKLFNEILQTRQIPEEWTECHIILLHKKGTRDEIGNYRPISLISNIYKVFAKVILERISLTLNESQPAEQAGFRKGFSTIDHIHTIKQLIQKYNEYNKQIYLAFIDYSKAFDSLRHQYIWRSLEQQGVQSNYIEILKSIYKSSKASIKLE

Summary

EMBL
FJ265564    ADI61832.1    KZ150485    PZC70710.1    FJ265561    ADI61829.1    + More
FJ265562    ADI61830.1    ODYU01008249    SOQ51673.1    KZ150191    PZC72397.1    FJ265563    ADI61831.1    KZ149907    PZC78256.1    GBGD01000380    JAC88509.1    JARK01000254    EYC39481.1    KZ150317    PZC71439.1    GBBI01004876    JAC13836.1    AAGJ04050748    ODYU01004088    SOQ43598.1    JARK01001639    EYB85201.1    JARK01001389    EYC11015.1    JARK01001471    EYB97918.1    RSAL01001818    RVE40675.1    CAVP010059842    CDL96135.1    JARK01001383    EYC12427.1    JARK01001531    EYB92324.1    FJ265542    ADI61810.1    JARK01001568    EYB89432.1    JARK01001340    EYC31303.1    JARK01001473    EYB97806.1    JARK01001388    EYC11159.1    JARK01001430    EYC03362.1    JARK01001380    EYC13156.1    EYC13157.1    JARK01001378    EYC13977.1    JARK01000247    EYC39651.1    JARK01001517    EYB93530.1    JARK01001406    EYC07496.1    EYC31302.1    JARK01001359    EYC20105.1    JARK01000188    EYC40939.1    JARK01001350    EYC24455.1    JARK01001435    EYC02496.1    JARK01000302    EYC38674.1    JARK01001630    EYB85641.1    JARK01001404    EYC07943.1    MRZV01002136    PIK34564.1    JARK01001348    EYC25050.1    JARK01000248    EYC39628.1    EYC25048.1    JARK01001366    EYC17452.1    JARK01001502    EYB94855.1    JARK01001470    JARK01000204    EYB98082.1    EYC40602.1    JARK01001365    EYC18010.1    EYB98081.1    EYC40601.1    JARK01001648    EYB84654.1    JARK01000077    EYC43894.1    EYC13322.1    EYB84655.1    EYB84653.1    EYC17448.1    EYC18009.1    JARK01001384    EYC12189.1    EYC17450.1    JARK01000008    EYC46079.1    EYC24454.1    JARK01000132    EYC42415.1    EYC25046.1    EYC24456.1    JARK01001428    EYC03684.1    JARK01001372    EYC15614.1    JARK01000078    EYC43871.1    JARK01001475    EYB97550.1    JARK01000109    EYC42952.1    EYC10874.1    EYC30744.1    JARK01001357    EYC20551.1    JARK01000063    EYC44387.1    JARK01001338    EYC33297.1    JARK01001497    EYB95322.1    JARK01001432    EYC03125.1    JARK01001637    EYB85284.1    JARK01001421    EYC04912.1    JARK01001628    JARK01001583    JARK01001528    JARK01001506    JARK01001467    JARK01001463    JARK01001457    JARK01001420    JARK01001403    JARK01001371    JARK01001369    JARK01001360    JARK01001353    JARK01001349    JARK01000603    JARK01000080    EYB85741.1    EYB88438.1    EYB92544.1    EYB94540.1    EYB98080.1    EYB98468.1    EYB98899.1    EYB99568.1    EYC03088.1    EYC05014.1    EYC08153.1    EYC15852.1    EYC16408.1    EYC19456.1    EYC22445.1    EYC24734.1    EYC24778.1    EYC24866.1    EYC33488.1    EYC35672.1    EYC43798.1    JARK01001581    EYB88505.1    JARK01001401    EYC08686.1    JARK01001344    EYC28216.1    EYC25049.1    JARK01001612    EYB86585.1    JARK01001655    EYB84321.1    JARK01000165    EYC41537.1    JARK01001500    JARK01001343    EYB95040.1    EYC28825.1    FJ265551    ADI61819.1    JARK01001407    EYC07212.1    JARK01000802    EYC34990.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF05047   L51_S25_CI-B8
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR016186   C-type_lectin-like/link_sf       
IPR016187   CTDL_fold       
IPR029052   Metallo-depent_PP-like       
IPR007741   Ribosome/NADH_DH       
IPR036249   Thioredoxin-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF56436   SSF56436       
SSF52833   SSF52833       
Gene 3D

Ontologies

Topology

Length:
333
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00267
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02137
outside
1  -  333
 
 

Population Genetic Test Statistics

Pi
172.496535
Theta
70.443142
Tajima's D
3.389555
CLR
0
CSRT
0.992850357482126
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号