SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08917
Annotation
AF461149_1_transposase_[Bombyx_mori]
Full name
Signal transducer and activator of transcription      
Location in the cell
Cytoplasmic   Reliability : 1.389 Nuclear   Reliability : 1.744
 

Sequence

CDS
ATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGTTCATAGAGTGAAGAGCACACAAGACTGCCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGGAACACTTGGAGGAAAAGGCGTGCTCAAAGTCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MFNNRHWVFQQDSAPVHRVKSTQDCLAAREIDFIRHEDWPSSSPDLNPLDYKIWEHLEEKACSKSHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Similarity
Belongs to the TGF-beta family.
Belongs to the transcription factor STAT family.
Belongs to the UDP-glycosyltransferase family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB473770    BAH20555.1    + More
AB363006    AB363010    AB363014    BAG15923.1    BAG15924.1    AB363018    BAG15926.1    RSAL01000021    RVE52408.1    RSAL01000191    RVE44681.1    RSAL01000084    RVE48403.1    RSAL01000012    RVE53510.1    RSAL01000114    RVE46946.1    RSAL01000387    RVE42024.1    RSAL01000931    RVE41042.1    RSAL01000063    RVE49524.1    RSAL01000140    RVE46091.1    RSAL01000205    RVE44371.1    RSAL01000300    RVE42771.1    RSAL01000131    RVE46422.1    RSAL01000004    RVE54604.1    RSAL01000174    RVE45058.1    RSAL01000209    RVE44259.1    RSAL01000149    RVE45804.1    RSAL01000333    RVE42475.1    RSAL01000070    RVE49180.1    RSAL01000006    RVE54275.1    RSAL01000392    RVE41996.1    RSAL01000453    RVE41665.1    RSAL01000022    RVE52367.1    RSAL01000470    RVE41612.1    RSAL01000236    RVE43715.1    RSAL01001770    RVE40705.1    RSAL01000200    RVE44486.1    RSAL01000184    RVE44863.1    U47917    AAB47739.1    LNIX01000030    OXA41211.1    JF779677    AEO90418.1    PDUG01000005    PIC23776.1    DS268612    EFO94085.1    UYSL01022144    VDL79905.1    UYSL01002425    VDL65835.1    JARK01001601    EYB87313.1    KN729202    KIH62598.1    JOJR01000583    RCN36166.1    PDUG01000001    PIC51673.1    UYSL01009772    VDL68385.1    PIC29926.1    UYSL01019905    VDL71189.1    JARK01001337    EYC34439.1    UYSL01020634    VDL75527.1    JARK01001471    EYB97976.1    CAVP010058755    CDL95145.1    JOJR01000015    RCN51257.1    DS268433    EFO97645.1    DS268747    EFP00909.1    UZAH01026445    VDO80847.1    PDUG01000006    PIC20538.1    DS268420    EFO87874.1    JARK01001658    EYB84158.1    UYSL01019770    VDL69590.1    UYSL01023059    VDL81638.1    UYSL01021399    VDL78127.1    UYSL01019810    VDL70150.1    UZAH01031030    VDP13493.1    KI662043    ETN73029.1    DS268492    EFP11689.1    PDUG01000004    PIC32571.1    EFP11674.1    KN726559    KIH67820.1    UZAH01001595    VDO19836.1    UYSL01020631    VDL75518.1    DS268565    EFO90304.1    JARK01001411    EYC06502.1    DS268606    EFO93488.1    DS268466    EFP06959.1    DS268508    EFO83264.1    DS268428    EFO94379.1    KN728435    KIH63782.1    PDUG01000012    PIC13506.1    DS268421    EFO88618.1    DS268673    EFO98001.1   
Pfam
PF00019   TGF_beta        + More
PF00431   CUB
PF00722   Glyco_hydro_16
PF07776   zf-AD
PF16095   COR
PF00069   Pkinase
PF00868   Transglut_N
PF01017   STAT_alpha
PF02864   STAT_bind
PF00017   SH2
PF02865   STAT_int
PF05485   THAP
PF00005   ABC_tran
PF07992   Pyr_redox_2
PF00201   UDPGT
PF00292   PAX
PF13358   DDE_3
PF10320   7TM_GPCR_Srsx
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR000859   CUB_dom       
IPR035914   Sperma_CUB_dom_sf       
IPR000757   GH16       
IPR013320   ConA-like_dom_sf       
IPR012934   Znf_AD       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR014756   Ig_E-set       
IPR013783   Ig-like_fold       
IPR001102   Transglutaminase_N       
IPR012345   STAT_TF_DNA-bd_N       
IPR008967   p53-like_TF_DNA-bd       
IPR013799   STAT_TF_prot_interaction       
IPR013800   STAT_TF_alpha       
IPR013801   STAT_TF_DNA-bd       
IPR000980   SH2       
IPR015988   STAT_TF_coiled-coil       
IPR001217   STAT       
IPR036535   STAT_N_sf       
IPR036860   SH2_dom_sf       
IPR038441   THAP_Znf_sf       
IPR006612   THAP_Znf       
IPR003439   ABC_transporter-like       
IPR017871   ABC_transporter_CS       
IPR003593   AAA+_ATPase       
IPR026082   ABCA       
IPR036188   FAD/NAD-bd_sf       
IPR023753   FAD/NAD-binding_dom       
IPR002213   UDP_glucos_trans       
IPR035595   UDP_glycos_trans_CS       
IPR036259   MFS_trans_sf       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR038717   Tc1-like_DDE_dom       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF49854   SSF49854       
SSF49899   SSF49899       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
SSF81296   SSF81296       
SSF48092   SSF48092       
SSF47655   SSF47655       
SSF49417   SSF49417       
SSF55550   SSF55550       
SSF51905   SSF51905       
SSF103473   SSF103473       
PDB
5CR4     E-value=3.78368e-07,     Score=123

Ontologies

Topology

Subcellular location
Secreted  
Cytoplasm  
Nucleus  
Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.29137
outside
1  -  111
 
 

Population Genetic Test Statistics

Pi
0.000179
Theta
0.002162
Tajima's D
-0.106878
CLR
2.211347
CSRT
0.00404979751012449
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号