SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08879
Annotation
reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.454
 

Sequence

CDS
ATGGCGCCGCAATTCCAAGGAGTATCCTTGCAAGATTCCGAGAGTATTGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCATCCAAAATGCTGGGAGTCCGCAACAGAGCAAAGCGGTACTTCACACCTGGACAAAGGATTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTATTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGCTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTAATTGTTCGAGATGATACCGACATCTCGTTCTTACCATCGCACCGCCCGTCACCGGAGTAG
Protein
MAPQFQGVSLQDSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVRNRAKRYFTPGQRILLYKAQVRPRVEYCSHLWAGAPKYQLIPFDSIQRRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELIVRDDTDISFLPSHRPSPE

Summary

EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    RSAL01000487    RVE41561.1    + More
RSAL01000109    RVE47192.1    RSAL01002067    RVE40593.1    RSAL01000164    RVE45343.1    RSAL01002827    RVE40408.1    RSAL01000090    RVE48098.1    RSAL01002868    RVE40398.1    RSAL01003136    RVE40332.1    RSAL01000422    RVE41792.1    RSAL01000002    RVE54942.1    RVE55041.1    RVE55094.1    RSAL01000072    RVE49051.1    ODYU01002162    SOQ39302.1    AMCI01002135    EJX03495.1    RSAL01000007    RVE54134.1    ODYU01007423    SOQ50184.1    GDRN01105059    JAI57791.1    HAAD01001474    CDG67706.1    DPOC01000269    HCX22453.1    LWDP01000391    ORD92879.1    ODYU01001348    SOQ37407.1    RSAL01000157    RVE45592.1    GFAC01000919    JAT98269.1    GADI01001229    JAA72579.1    MRZV01001153    PIK40187.1    GEGO01005479    JAR89925.1    GEFM01006250    JAP69546.1    GEFM01001453    JAP74343.1    GANP01010944    JAB73524.1    AAGJ04110620    GDRN01111278    JAI56803.1    MRZV01000519    PIK48495.1    GEFM01002306    JAP73490.1    GDRN01111277    JAI56804.1    GEGO01003111    JAR92293.1    GEFM01002324    JAP73472.1    GFWV01002422    MAA27152.1    GFAA01003161    JAU00274.1    GFAA01000199    JAU03236.1    KL206225    KFV80018.1    GEGO01004630    JAR90774.1    GECZ01018152    JAS51617.1    GECZ01005534    JAS64235.1    KL206694    KFV84978.1    MRZV01002157    PIK34500.1    KL206955    KFV87539.1    GBBK01004986    JAC19496.1    GEGO01003895    JAR91509.1    JH815916    EKC31648.1    KL206020    KFV77928.1    KL206974    KFV87692.1    KL205964    KFV77614.1    KL205741    KFV73823.1    KL205665    KFV72673.1    GEGO01007187    JAR88217.1    KL206526    KFV83081.1    GANP01010782    JAB73686.1    KL205979    KFV77661.1    KL206805    KFV85878.1    KL206341    KFV81395.1    KL206333    KFV81308.1    KL225891    KFM04405.1    GEGO01002025    JAR93379.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01873   eIF-5_eIF-2B
PF04939   RRS1
PF15613   WSD
PF01585   G-patch
PF08159   NUC153
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR007023   Ribosom_reg       
IPR028941   WHIM2_dom       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR036291   NAD(P)-bd_dom_sf       
IPR002347   SDR_fam       
IPR020904   Sc_DH/Rdtase_CS       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR039779   RFX-like       
IPR038751   Int8       
IPR028082   Peripla_BP_I       
SUPFAM
SSF56219   SSF56219        + More
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF54928   SSF54928       
SSF51735   SSF51735       
SSF50978   SSF50978       
SSF53822   SSF53822       
Gene 3D

Ontologies

Topology

Length:
155
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00019
Exp number, first 60 AAs:
0.00019
Total prob of N-in:
0.03551
outside
1  -  155
 
 

Population Genetic Test Statistics

Pi
115.973449
Theta
106.069009
Tajima's D
-0.353239
CLR
0
CSRT
0.281685915704215
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号