SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08874
Annotation
NA
Location in the cell
Nuclear   Reliability : 3.223
 

Sequence

CDS
ATGTCAGCAAAAAGTTCAAAGAAACGTCCAAAAATACGCTTGTTCGACGATTTTTCATCAAATTCGCCATCTGAAGCAGATTTAGATCCCTTCGAGGATAATGACGGTGAGTATGGTTCTGACACGAACTATGAACCACAAAATATAGAAGAAACTGGTGCATCCAGTTCATCAGAGGAAATATTTTCTATAAGACCTTGTCGAAAATACTCATTTCTGATGTGTAAAATGTGTTCCAAAGAATAA
Protein
MSAKSSKKRPKIRLFDDFSSNSPSEADLDPFEDNDGEYGSDTNYEPQNIEETGASSSSEEIFSIRPCRKYSFLMCKMCSKE

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
81
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.66532
inside
1  -  81
 
 

Population Genetic Test Statistics

Pi
131.266217
Theta
131.137771
Tajima's D
0.749312
CLR
54.508308
CSRT
0.589970501474926
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号