SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08822
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.308 Mitochondrial   Reliability : 1.731 Nuclear   Reliability : 1.609
 

Sequence

CDS
ATGATTGCACACCGCAGAACCAGGCCCCTAGTCCCCGGCGGCCCCGCTAGTCCTGGTTACGGTAGCGGCCATGGTAACGGCGGGGCAAGGGGTGCTAAGAATCCCCGGCAGAGATCCGACTACCACCCCCCTTCACAACGACAACTGGCCCTGGTGACATACAACGTGCGCACTTTGAGGTTGGACGAGAAGCTAATAGAGCTGGAAGAAGAAATGAACAAGTTGCGCTGGGACGTTATTGGTTTATCGGAGATCCGAAGAGAGGGGGAGGATACGAAAACCTTACAGTCCGGCCACTTGTTCTACTACCGGGAGGGAGAACAGAAGTCCCAAGGTGGTGTTGGGTTTATCGTCCACAAATCTCTCATAAAGAACATTATGGCCATCGAAAGTGTGTCGAGTATACCTTGTCCTCAAAATCTCAAAGCGGTATTCGCTGAAGATTGTACAGGCGATGATGAGTTGAAAGTCGGGGCCATTTGGATTTGGGCAGCGGAATCCCAGAGGACAGATGCTGGCGGACTTTATGGAGAAGGAAGGACTCTTTATGATGAATTCTTTCTTCAAGAAGCCGCCATAACGGAAATGGACCTGCGTATCAAAGAGACGATTGAGCGAAACCAAGGCTCTAAAGTGTTCGCAAGAGACGCTTCTATTGGGCAAAGCCAGCTAACGAAGCTGAAGACCGAAGATGGACGTGTAACGTCGAATAGGTCAGAGGTCCTGCGGGAGATAGAGACGTTCTACGGGCAGCTGTTTACCTCGGTCTCAGCTGAACCGCAAGGTTTAGCTGCAGACCCTAGAGCCAAGCTAACCCGACACTACACCGAAGACATCCCGGACATCAGCCTGTACGAGATTAGGATGGCTCTCAAACAGCTTAAGAATAACGAGGCACCGGGCGAGGATGGAATTACTACGGAGCTTCTGAAAGCGGGCGGGACGCCGGTACTGAAAGTCCTTCAGAAGCTCTTCAATTCCTCTTTGCTCGATGGAAAACCGCCACAGGCATGGAATAGGGGTGTTGTGATCCTGTTCTTCAAAAAAGGTGACAAAACCTTATTGAAGAACTACAGGCCCATAGCTCTGCTGAGCCATGTCTACAAGCTGTTCTCGAGAGTCATCACGAAGCGTCTCGAACGCAGGTTTGATGACTTCCAGCCTACCGAACAAGCCGGTTTCCGAAAAGGCTACAGTACCATAGACCACATACATACGCTGCGGCAGATTGTACAGAAGACCGAAGAGTACAATCGGCCATTATGCTTAGCGTTTGTGGACTATGAGAAAGCCTTTCATTCCGTCGAAACATGGGCGGTCCTTAGATCTCTCCAGCGGTGCCGTATTGACCACCGGCCGCAACTACTTCGCAGCCAGGTGTAA
Protein
MIAHRRTRPLVPGGPASPGYGSGHGNGGARGAKNPRQRSDYHPPSQRQLALVTYNVRTLRLDEKLIELEEEMNKLRWDVIGLSEIRREGEDTKTLQSGHLFYYREGEQKSQGGVGFIVHKSLIKNIMAIESVSSIPCPQNLKAVFAEDCTGDDELKVGAIWIWAAESQRTDAGGLYGEGRTLYDEFFLQEAAITEMDLRIKETIERNQGSKVFARDASIGQSQLTKLKTEDGRVTSNRSEVLREIETFYGQLFTSVSAEPQGLAADPRAKLTRHYTEDIPDISLYEIRMALKQLKNNEAPGEDGITTELLKAGGTPVLKVLQKLFNSSLLDGKPPQAWNRGVVILFFKKGDKTLLKNYRPIALLSHVYKLFSRVITKRLERRFDDFQPTEQAGFRKGYSTIDHIHTLRQIVQKTEEYNRPLCLAFVDYEKAFHSVETWAVLRSLQRCRIDHRPQLLRSQV

Summary

Pfam
PF00078   RVT_1
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

GO

Topology

Length:
460
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00798
Exp number, first 60 AAs:
0.00034
Total prob of N-in:
0.00988
outside
1  -  460
 
 

Population Genetic Test Statistics

Pi
272.870512
Theta
209.410799
Tajima's D
0.929065
CLR
0
CSRT
0.63686815659217
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号