SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08784
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.144
 

Sequence

CDS
ATGAAATTAATGGTGGTGGATCGTGCAAATGTTCTAAGATTGAATGGGGCGCTTGGATTAGAGGTTGTAGACGAATTCGTGTATCTCGGGTCCTGCATCAGCAACAAAGGCTCATGTGAAACTGACGTGCGCCGACGTATCGGAATGGCTAAAAGTGCGATGTCTCAGCTACAGAAGATCTGGAAGAATAGAGGGATAGGCCTGAAAACTAAAACCAGACTGGTGCGGACTCTTGTTTTCTCTATCTTCTTGTATGGAGCTGAGACATGGACGTTGAAAGCAGCAGACCGAATGCGCATCGATGCTTTCGAAATGTGGTGTTGGAGACGCATGCTAAGAATTCCGTGGACAGCCTTCCGGACTAACGTGTCGATATTGAAGCAACTGGGCATCAAAATCAGACTGTCTACTGTATGTCTGAAGCGGATCCTCGAATATTTTGGTCACATTGCGAGGAAAGACGGCGATAACCTGGAAAAACTTATGATCACAGGGAAAGTTGAAGGCAACAGATCTAGAGGCCGCAACCATACTCGTTGGTCCGATCAGATCCGCACCGCTTTGGACAGTACAGTGTACAGCGCGCTGCATGACGCCGTGGACAGAGGGAAAGTGGAAAAAGATCCTAAGATTGAAGCTCATGGGTGA
Protein
MKLMVVDRANVLRLNGALGLEVVDEFVYLGSCISNKGSCETDVRRRIGMAKSAMSQLQKIWKNRGIGLKTKTRLVRTLVFSIFLYGAETWTLKAADRMRIDAFEMWCWRRMLRIPWTAFRTNVSILKQLGIKIRLSTVCLKRILEYFGHIARKDGDNLEKLMITGKVEGNRSRGRNHTRWSDQIRTALDSTVYSALHDAVDRGKVEKDPKIEAHG

Summary

EMBL
FJ265548    ADI61816.1    FJ265557    ADI61825.1    ODYU01004401    SOQ44236.1    + More
FJ265553    ADI61821.1    FJ265546    ADI61814.1    FJ265547    ADI61815.1    RSAL01000289    RVE42931.1    ODYU01001007    SOQ36619.1    KZ150203    PZC72267.1    GU815090    ADF18553.1    FJ265560    ADI61828.1    ODYU01003523    SOQ42419.1    FJ265552    ADI61820.1    RSAL01000427    RVE41762.1    MRZV01002322    PIK33998.1    MRZV01001207    PIK39730.1    BDOT01000049    GCF48199.1    MRZV01001216    PIK39650.1    MRZV01000994    PIK41715.1    MRZV01000196    PIK55924.1    MRZV01000817    PIK43880.1    BDOT01000029    GCF46213.1    BDOT01000022    GCF45060.1    BDOT01000136    GCF52589.1    BDOT01000045    GCF47862.1    BDOT01000018    GCF44776.1    BDOT01000127    GCF52250.1    BDOT01000043    GCF47709.1    GCF47683.1    BDOT01000102    GCF51323.1    BDOT01000067    GCF49499.1    GCF48161.1    BDOT01000058    GCF48816.1    BDOT01000084    GCF50558.1    BDOT01000240    GCF55388.1    BDOT01000020    GCF44950.1    GCF44774.1    BDOT01000075    GCF50047.1    BDOT01000476    GCF58985.1    BDOT01000002    GCF40281.1    BDOT01000028    GCF46025.1    BDOT01000069    GCF49671.1    BDOT01000005    GCF41659.1    GCF44896.1    BDOT01000150    GCF53026.1    BDOT01000016    BDOT01001142    GCF44381.1    GCF61716.1    BDOT01000096    GCF51106.1    BDOT01000074    GCF50011.1    BDOT01000015    GCF44244.1    GCF41533.1    BDOT01000161    GCF53338.1    GCF44715.1    BDOT01000090    GCF50896.1    BDOT01000123    GCF52043.1    BDOT01000055    GCF48663.1    BDOT01000065    GCF49384.1    GCF44764.1    GCF44759.1    BDOT01000110    GCF47846.1    GCF51642.1    GCF44750.1    BDOT01000078    GCF50245.1    BDOT01000333    GCF57251.1    BDOT01000006    GCF41929.1    BDOT01000024    BDOT01000208    GCF45062.1    GCF45289.1    GCF54601.1    BDOT01000298    GCF56713.1    BDOT01000816    GCF60864.1    GCF49634.1    BDOT01000040    GCF47495.1    BDOT01000011    GCF43472.1    BDOT01000073    GCF49926.1    GCF44200.1    GCF41907.1    BDOT01000203    GCF54495.1    GCF41638.1    GCF49423.1    BDOT01000105    GCF51453.1    GCF40389.1    GCF44946.1    BDOT01000335    GCF57283.1    GCF41639.1    BDOT01000038    GCF47337.1    BDOT01000082    GCF50401.1    BDOT01000063    GCF49303.1    GCF57285.1    BDOT01000031    GCF46419.1    GCF41567.1    BDOT01000083    GCF50491.1    BDOT01000066    GCF49478.1    BDOT01000017    GCF44644.1    GCF40329.1    BDOT01000054    GCF48586.1    GCF41954.1    GCF48642.1    GCF49500.1    BDOT01000374    GCF57846.1    GCF44937.1    BDOT01000052    GCF48459.1    BDOT01000234    GCF55219.1    GCF41453.1    BDOT01000484    GCF59029.1    BDOT01000001    GCF39783.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF02146   SIR2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR029035   DHS-like_NAD/FAD-binding_dom       
IPR003000   Sirtuin       
IPR026590   Ssirtuin_cat_dom       
IPR030431   FAM189       
SUPFAM
SSF56219   SSF56219        + More
SSF52467   SSF52467       
Gene 3D

Ontologies

Topology

Length:
215
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
7.07512
Exp number, first 60 AAs:
0.01651
Total prob of N-in:
0.44880
outside
1  -  215
 
 

Population Genetic Test Statistics

Pi
243.964223
Theta
160.113104
Tajima's D
1.646816
CLR
0.000004
CSRT
0.814459277036148
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号