SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08781
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.692
 

Sequence

CDS
ATGCGCAAAACCCTAGAGGAGTGGGATGGTGGCGTCACAGTTGGGGGCGTAAAGATCTCGAACTTACGATACGCTGATGATACCACATTAGTGGCGTCATCAGAAGAGGAAATGGAGGAGCTGCTGCGACGTCTGGTTATAGTTAGCGAGGAAATGGGACTAAAGATCAACCAGTCCAAAACAAAGATCATGATCGTGGATAAATACGGCACCCTTAACGAGAATAATATTCTTGGCCAATACGACATCGTCAAGACTTTCGTGTACCTCGGCTCGATTATTTCCAATAGAGGTGGATCGGAAACCGAAATAAGGCGACGCATCGGAATGGCCAAATCCGCTATGAGCCAGCTAAACAAAATATGGAGAGATCGAAACATACTCAAGAAAACGAAAGTGCAAATTGTTGAGACGCTCGTTTTCTTAATCTTTTTGTATGGGGCTGAGACCTGGATCTTGAAAGAGTCTGACAGGCGACGCATAGACGCGTTTGAGATGTGGTGCTGGCGGCGCATGTTGCGCATCCCTTGGACGGCTTTCCGGACGAACGCTTCCATCCTCAACGAGCTAAAAGTTGACCAGAGGCTATCCACCAAATGTCTATATAGAGTGCTCCAATACTTTGGTCATATAGCAAGAAAACCCTCTGACAACCTGGAGAGACTCATAGTGACGGGTAAAGTGGATGGAAGACGATCCAGAGGTCGTAGCCGAAAAAGATGGAGTGACCAAGTGTCTGAGTGTCTGGACATGAGACTGAGCCACGCACTTCACTGTGCCACAGACCGACATAAGTGGCTACAAATTACAAAAAAAGGTCACAGGCGGGCGCATCACGATGCTCAGCAATGA
Protein
MRKTLEEWDGGVTVGGVKISNLRYADDTTLVASSEEEMEELLRRLVIVSEEMGLKINQSKTKIMIVDKYGTLNENNILGQYDIVKTFVYLGSIISNRGGSETEIRRRIGMAKSAMSQLNKIWRDRNILKKTKVQIVETLVFLIFLYGAETWILKESDRRRIDAFEMWCWRRMLRIPWTAFRTNASILNELKVDQRLSTKCLYRVLQYFGHIARKPSDNLERLIVTGKVDGRRSRGRSRKRWSDQVSECLDMRLSHALHCATDRHKWLQITKKGHRRAHHDAQQ

Summary

EMBL
FJ265557    ADI61825.1    FJ265548    ADI61816.1    FJ265546    ADI61814.1    + More
FJ265553    ADI61821.1    KZ150203    PZC72267.1    FJ265547    ADI61815.1    FJ265552    ADI61820.1    ODYU01004401    SOQ44236.1    RSAL01000289    RVE42931.1    FJ265560    ADI61828.1    GU815090    ADF18553.1    MRZV01002322    PIK33998.1    BDOT01000028    GCF46025.1    BDOT01000005    BDOT01000065    GCF41638.1    GCF49423.1    BDOT01000006    GCF41907.1    BDOT01000039    GCF47378.1    GCF41453.1    BDOT01000020    GCF44940.1    BDOT01000010    GCF43212.1    BDOT01000165    GCF53438.1    BDOT01000008    GCF42801.1    BDOT01000105    GCF51467.1    BDOT01000066    GCF49478.1    BDOT01000031    GCF46419.1    BDOT01000648    GCF60106.1    BDOT01000055    GCF48642.1    BDOT01000040    GCF47493.1    BDOT01000335    GCF57285.1    BDOT01000018    GCF44774.1    BDOT01000163    GCF53402.1    BDOT01000073    GCF49926.1    BDOT01000016    GCF44533.1    BDOT01000484    GCF59029.1    GCF53435.1    BDOT01000101    GCF51285.1    BDOT01000022    GCF45125.1    BDOT01000002    GCF40240.1    BDOT01000043    GCF47717.1    BDOT01000102    GCF51323.1    BDOT01000168    GCF53540.1    GCF39995.1    BDOT01000130    GCF52365.1    GCF47371.1    BDOT01000067    GCF49500.1    BDOT01000015    BDOT01000148    GCF44364.1    GCF48654.1    GCF52988.1    GCF49387.1    BDOT01000104    GCF51438.1    BDOT01000089    GCF50820.1    BDOT01000103    GCF51376.1    BDOT01000474    GCF58974.1    BDOT01000062    GCF49174.1    BDOT01000143    GCF52806.1    GCF40256.1    BDOT01000054    GCF48637.1    BDOT01000116    GCF51880.1    GCF48602.1    BDOT01000153    GCF53117.1    GCF40190.1    GCF41961.1    GCF46132.1    BDOT01000127    GCF52250.1    GCF44750.1    BDOT01000111    GCF51686.1    GCF44894.1    BDOT01000048    GCF48010.1    GCF44767.1    GCF44935.1    GCF40380.1    MRZV01000196    PIK55924.1    BDOT01000149    GCF53002.1    GCF52369.1    BDOT01000029    GCF46280.1    GCF47356.1    GCF45060.1    BDOT01000096    GCF51115.1    GCF48608.1    BDOT01000090    GCF50913.1    BDOT01000038    GCF47291.1    GCF44549.1    BDOT01000094    GCF51029.1    GCF51451.1    GCF40355.1    GCF48031.1    GCF41553.1    BDOT01000112    GCF51757.1    MRZV01001207    PIK39730.1    GCF40140.1    BDOT01000156    GCF53186.1    GCF47377.1    BDOT01000084    GCF50558.1    BDOT01000229    GCF55077.1    GCF40308.1    BDOT01000001    GCF39524.1    BDOT01000134    GCF52506.1    GCF47419.1    BDOT01000011    GCF43541.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF13863   DUF4200
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002138   Pept_C14_p10       
IPR025252   DUF4200       
IPR039034   INPP4       
IPR035892   C2_domain_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
283
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
10.31896
Exp number, first 60 AAs:
0.00053
Total prob of N-in:
0.45638
outside
1  -  283
 
 

Population Genetic Test Statistics

Pi
313.859777
Theta
163.973672
Tajima's D
2.786395
CLR
177.538813
CSRT
0.968351582420879
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号