SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08439
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 2.076 Nuclear   Reliability : 1.706
 

Sequence

CDS
ATGCCGCGCTTTGTTGAAGCGGTACACGGGAAAAAAATATCGGGAAATTCTGTTTCGGATGAAAAAATTTTTACCGTAGAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCTTCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGCAGTTGTGTATCAAAATACAGTCCTGACGAATCTTGTGGAACCTGTTTCTCATTCCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAA
Protein
MPRFVEAVHGKKISGNSVSDEKIFTVEESYNKQNDKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNAVVYQNTVLTNLVEPVSHSMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLQDMATLGGKGVLKASSQFGVTQDILD

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
AF461149    AAN06610.1    AB363028    BAG15927.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB473770    BAH20555.1    AB363018    BAG15926.1    RSAL01000084    RVE48403.1    RSAL01000012    RVE53510.1    KQ459680    KPJ20472.1    RSAL01001770    RVE40705.1    U47917    AAB47739.1    JF779677    AEO90418.1    RSAL01002114    RVE40580.1    RSAL01000016    RVE53060.1    RSAL01000063    RVE49524.1    RSAL01000144    RVE45972.1    RSAL01000039    RVE51021.1    RSAL01000006    RVE54275.1    RSAL01000191    RVE44681.1    RSAL01000140    RVE46091.1    RSAL01000021    RVE52408.1    RSAL01000133    RVE46339.1    LNIX01000030    OXA41211.1    KN726990    KIH66733.1    RSAL01000092    RVE47954.1    JARK01001411    EYC06502.1    PDUG01000005    PIC23776.1    JOJR01000583    RCN36166.1    JOJR01000015    RCN51257.1    JARK01001345    EYC27589.1    JARK01000176    EYC41234.1    CAVP010059404    CDL95787.1    DS268539    EFO88027.1    PDUG01000012    PIC13506.1    JARK01000131    EYC42467.1    DS268492    EFP11689.1    DS268747    EFP00909.1    JARK01001418    EYC05389.1    DS268466    EFP06959.1    DS268679    EFO98285.1    DS268428    EFO94379.1    DS268545    EFO88382.1    DS268508    EFO83264.1    DS268525    EFO85497.1    EFP11674.1    UYSL01019905    VDL71189.1    DS268606    EFO93488.1    DS268421    EFO88618.1    HE601413    CAS00486.1    DS268673    EFO98001.1    PIC28734.1    DS268565    EFO90304.1    JARK01000059    EYC44525.1    UZAH01001595    VDO19836.1    PIC29926.1    PDUG01000001    PIC51673.1    JARK01001390    EYC10681.1    DS268612    EFO94085.1    JARK01000073    EYC44053.1    JARK01001499    EYB95145.1    JARK01001601    EYB87313.1    KX931010    APL98300.1    KA646003    AFP60632.1    PDUG01000006    PIC20538.1    JARK01001337    EYC34439.1   
Pfam
PF00019   TGF_beta        + More
PF13358   DDE_3
PF16095   COR
PF00069   Pkinase
PF02893   GRAM
PF00292   PAX
Interpro
IPR009057   Homeobox-like_sf        + More
IPR001839   TGF-b_C       
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR038717   Tc1-like_DDE_dom       
IPR036259   MFS_trans_sf       
IPR032171   COR       
IPR020859   ROC_dom       
IPR000719   Prot_kinase_dom       
IPR011047   Quinoprotein_ADH-like_supfam       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR027417   P-loop_NTPase       
IPR004182   GRAM       
IPR011993   PH-like_dom_sf       
IPR036388   WH-like_DNA-bd_sf       
IPR001523   Paired_dom       
SUPFAM
SSF46689   SSF46689        + More
SSF57501   SSF57501       
SSF103473   SSF103473       
SSF56112   SSF56112       
SSF52540   SSF52540       
SSF50998   SSF50998       
Gene 3D
PDB
5CR4     E-value=1.11528e-07,     Score=130

Ontologies

Topology

Subcellular location
Secreted  
Length:
179
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.18427
Exp number, first 60 AAs:
0.03975
Total prob of N-in:
0.05253
outside
1  -  179
 
 

Population Genetic Test Statistics

Pi
62.152221
Theta
43.973171
Tajima's D
1.2459
CLR
0
CSRT
0.731563421828909
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号