SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08427
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.847 Nuclear   Reliability : 1.897
 

Sequence

CDS
ATGTGGTGCTACCGTCGCATGTTACGCATTGGTTGGACGCAGAGGGTCAGGAACGAAACCGTGCTTCAGCGCGTTCATATGTCCCGGAAAATGCTGCCTGCTATCAAAAAGCGCAAGATAGAGTATCTCGGCCACGTGCTCAGGAACGATCGATACATGCTACTCCAGCTGATAATTATGGGCAAAGTGGACGGAAAGAGACGTGCTGGGCGAAGAAAGAAATCATGGCTCCGGAATATCCGGGAGTGGACCGGTATTGCCTCCGTCGAACAGCTGTTCCGGCTGGCTGCAGATAAAAACGAATATAGAAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MWCYRRMLRIGWTQRVRNETVLQRVHMSRKMLPAIKKRKIEYLGHVLRNDRYMLLQLIIMGKVDGKRRAGRRKKSWLRNIREWTGIASVEQLFRLAADKNEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ977522    KYN02133.1    + More
GBHO01041897    JAG01707.1    GDHC01017214    JAQ01415.1    KQ460652    KPJ12975.1    RSAL01000055    RVE49910.1    GBRD01005612    JAG60209.1    GGMS01008711    MBY77914.1    LBMM01003995    KMQ92919.1    GBHO01028834    JAG14770.1    ODYU01000306    SOQ34818.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    LBMM01001656    KMQ95932.1    NWSH01001998    PCG69477.1    GGMS01004979    MBY74182.1    GGMS01000367    MBY69570.1    GGMR01005851    MBY18470.1    GGMR01013640    MBY26259.1    ABLF02012409    ABLF02012412    AFYH01119920    AAGJ04161766    BART01031562    GAH15691.1    KZ149985    PZC75696.1    KZ150019    PZC74919.1    NWSH01000469    PCG76200.1    HACG01049496    CEK96361.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    HACG01049256    CEK96121.1    HACG01049492    CEK96357.1    RQTK01000650    RUS76594.1    GGMR01016842    MBY29461.1    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    RQTK01000360    RUS81011.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    NEVH01002574    PNF41923.1    HACG01049254    CEK96119.1    NCKU01008836    RWS01655.1    NCKU01012182    RWS00163.1    LBMM01006413    KMQ90631.1    NCKU01006316    RWS03634.1    KZ149912    PZC78062.1    GGMR01016881    MBY29500.1    KK853131    KDR10935.1    RQTK01000058    RUS89376.1    KF881087    AIJ27486.1    NEVH01010478    PNF32508.1    RQTK01000625    RUS76894.1    KK852870    KDR14607.1    NCKU01004395    RWS06003.1    GDHC01009154    JAQ09475.1    GBHO01034555    JAG09049.1    HACG01049255    CEK96120.1    RQTK01000685    RUS76136.1    HACG01049245    CEK96110.1    HACG01049249    CEK96114.1    RQTK01000357    RUS81065.1    NEVH01009398    PNF33135.1    NEVH01004403    PNF39833.1    NEVH01023953    PNF17874.1    NEVH01025635    PNF15414.1    KF881086    AIJ27485.1    NEVH01007395    PNF35970.1    BDOT01000101    GCF51276.1    NEVH01017534    PNF24114.1    NEVH01020940    PNF20497.1    GGMS01001437    MBY70640.1    RQTK01000991    RUS72979.1    GBHO01033031    GBHO01015473    GBHO01015472    GBHO01015471    GBHO01015469    GBHO01013134    GBHO01013133    GBHO01013129    GBHO01013128    JAG10573.1    JAG28131.1    JAG28132.1    JAG28133.1    JAG28135.1    JAG30470.1    JAG30471.1    JAG30475.1    JAG30476.1    GDHC01007098    GDHC01001590    JAQ11531.1    JAQ17039.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR036640   ABC1_TM_sf       
IPR000637   HMGI/Y_DNA-bd_CS       
IPR036846   GM2-AP_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF90123   SSF90123       
SSF63707   SSF63707       
Gene 3D

Ontologies

Topology

Length:
111
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01983
Exp number, first 60 AAs:
0.00279
Total prob of N-in:
0.59319
inside
1  -  111
 
 

Population Genetic Test Statistics

Pi
7.00933
Theta
15.790354
Tajima's D
-1.736604
CLR
27.065887
CSRT
0.032248387580621
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号