SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08346
Pre Gene Modal
BGIBMGA009272
Annotation
PREDICTED:_transient_receptor_potential_protein_isoform_X1_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 2.255
 

Sequence

CDS
ATGAGTTGGGAATCAGTGGATTCCGACGGTGCCACCTTCACTCCGGATATCACGCCCCTGATACTGGCAGCGCACAGGAACCACTACGAGATCCTTAAGATCTTATTAGACAGAGGAGCGACGCTCCCGGTACCACACGACGTCAAATGCGGTTGCGACGAATGTGTGAAGTCCTCACAAGAGGATTCTCTGCGGCATTCTCAGGCTCGGATTAACGCATATCGCGCGCTTTCTTCGCCTTCACTCATAGCGTTATCGTCAGCTGACCCACTGCTGACGGCTTTCCAGCTGTCTTGGGAGTTGGGACGTCTGAGTCGAATGGAAACTGAGTTTAGAGTTGAATATAAGGCTTTACGTCAACAATGCCAAGAATTCGCCACCTCACTATTAGATCACACCAGAACCTCAAAGGAGTTAGAGATAATGCTCAACTACAACCCATGGGATTTGGACTGCTGGGAGCCCGGGGAAAGGCAAACACTTGGACGTCTCAAATTGGCTATCAAATACAAGCAAAAAATGTTTGTAGCACATCCTAATGTGCAGCAGTTATTGGGAGCAATCTGGTATGAAGGACTGCCGGGCTTCAAAAGGAAAAATATTTTCGGTCAATGCGTTCAGGTAGCAAAATTGGGGGTGATGTTTCCTGTTTACTGCACAATATACATGTTGGCCCCAAACTCAGAGTACGGCAGATTCATGAAAAAACCATTCGTCAAGTTTATTTGTCACAGTTCCTCTTACATGCTTTTCTTGACGTTGCTCTCACTGGCATCCCAAAGAGCGGAATATGTAGTACTAGAGTGGTCCAATGTAAGCTGGCTACAGGAATTAGTGGGATACTGGAAGGACCACGAAAGAGGATCTCTGCCTGGAGTCATTGAGTTCGCCGTCATTATCTACATAGCAAGTAAATTTGAGTTTGTTGGCATGCAATCTTTAAATCAATGTTATTTTAATAGTAAATCTTCATCTTAA
Protein
MSWESVDSDGATFTPDITPLILAAHRNHYEILKILLDRGATLPVPHDVKCGCDECVKSSQEDSLRHSQARINAYRALSSPSLIALSSADPLLTAFQLSWELGRLSRMETEFRVEYKALRQQCQEFATSLLDHTRTSKELEIMLNYNPWDLDCWEPGERQTLGRLKLAIKYKQKMFVAHPNVQQLLGAIWYEGLPGFKRKNIFGQCVQVAKLGVMFPVYCTIYMLAPNSEYGRFMKKPFVKFICHSSSYMLFLTLLSLASQRAEYVVLEWSNVSWLQELVGYWKDHERGSLPGVIEFAVIIYIASKFEFVGMQSLNQCYFNSKSSS

Summary

Similarity
Belongs to the transient receptor (TC 1.A.4) family.
EMBL
BABH01022307    BABH01022308    KZ150121    PZC73176.1    NWSH01004304    PCG65239.1    + More
PCG65240.1    RSAL01000028    RVE51850.1    AGBW02013881    OWR42590.1    KQ459786    KPJ19923.1    KQ459585    KPI98235.1    GECZ01017264    JAS52505.1    CVRI01000020    CRK91249.1    KC329816    AGG86916.1    AJWK01005767    PYGN01001038    PSN38237.1    GEDC01014250    JAS23048.1    CH477341    EAT43090.1    NEVH01020341    PNF21594.1    AAAB01008846    EAA06236.6    GBYB01002829    JAG72596.1    AXCM01000046    JXUM01063153    JXUM01063154    KQ562234    KXJ76346.1    APCN01004943    AXCN02001396    AXCN02001397    KQ434896    KZC10761.1    KM280572    AJD25385.1    KQ765605    OAD53838.1    ATLV01014688    ATLV01014689    KE524978    KFB39392.1    GFXV01004504    MBW16309.1    GFDL01004514    JAV30531.1    KQ435699    KOX80578.1    UFQT01000867    SSX27732.1    KQ981215    KYN44525.1    GL449658    EFN82264.1    DS233135    EDS28306.1    KX249688    AOR81465.1    KQ979074    KYN22778.1    GDIP01153685    JAJ69717.1    NNAY01004990    OXU17130.1    QOIP01000012    RLU15644.1    GL888237    EGI64238.1    KK107558    EZA48978.1    GDIP01177990    JAJ45412.1    GDIQ01202091    JAK49634.1    GDIQ01194891    JAK56834.1    GFXV01003366    MBW15171.1    GDIQ01250973    JAK00752.1    GDIQ01235446    JAK16279.1    GDHC01017644    JAQ00985.1    GDIP01177989    JAJ45413.1    GDIP01165468    JAJ57934.1    GL732531    EFX85740.1    GDIQ01157105    JAK94620.1    GDIQ01015497    JAN79240.1    GDIP01027505    JAM76210.1    ABLF02038759    ABLF02038765    ABLF02038771    GDHF01023703    JAI28611.1    KQ982316    KYQ57836.1    JRES01000338    KNC32158.1    KQ971338    KYB27779.1    JXJN01021660    JXJN01021661    CCAG010009340    GAKP01015917    JAC43035.1    GBXI01007439    JAD06853.1    Z80230    CAB02410.1    GL764026    EFZ18825.1    GAMC01006674    JAB99881.1    CH940652    EDW59053.1    AAZO01000650    DS235023    EEB10642.1    CP012526    ALC48014.1    CH916374    EDV90994.1    CH933806    EDW16292.1    KA644906    AFP59535.1    KZ288375    PBC26701.1    LJIJ01000448    ODM97382.1    CH902617    EDV44063.1    CH964272    EDW84353.1    CH479186    EDW39273.1    CM000070    EAL26747.2    OUUW01000005    SPP80904.1    SPP80905.1   
Pfam
PF08344   TRP_2        + More
PF00520   Ion_trans
PF12796   Ank_2
PF00023   Ank
PF00088   Trefoil
PF07898   DUF1676
Interpro
IPR002110   Ankyrin_rpt        + More
IPR013555   TRP_dom       
IPR002153   TRPC_channel       
IPR005821   Ion_trans_dom       
IPR020683   Ankyrin_rpt-contain_dom       
IPR036770   Ankyrin_rpt-contain_sf       
IPR017957   P_trefoil_CS       
IPR000519   P_trefoil_dom       
IPR012464   DUF1676       
SUPFAM
SSF48403   SSF48403       
Gene 3D
PDB
6G1K     E-value=7.58025e-71,     Score=678

Ontologies

Topology

Length:
325
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
27.18055
Exp number, first 60 AAs:
0.04308
Total prob of N-in:
0.20125
outside
1  -  325
 
 

Population Genetic Test Statistics

Pi
236.218684
Theta
158.66412
Tajima's D
1.248769
CLR
0.27169
CSRT
0.729663516824159
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号