SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08306
Annotation
hypothetical_protein_M513_10814?_partial_[Trichuris_suis]
Location in the cell
Nuclear   Reliability : 2.98
 

Sequence

CDS
ATGGAGGCAAACGAACAATTAGTAAGAGAAGGAAATACACTGTTACAAGAACAAAATGCCATCCTAAAGGCTGAATTACAAAAACTTAAAATGCAAGGCATCGATAAAACGGACCCACCCCCCACAGACCCATTATTTCCTCAACCTACCTCAGTATGCAGAGTAGCCATAAAACTTCCTCCCTTCTGGCCTGATCGACCTGCAATTTGGTTTGCTCAGGTAGAGGCACAGTTCTCGATTTCAGGCATCTCCGCTGACCGGACTAAATTTAACTACGTGATTGCTCAGTTAGATACCCGAGTTATTGGGGAGGTAGAGGACATTATTCTCCAACCATCACCTGAGGACAAATATGGTCGCCTCAAATCCGAGTTGATCCGTAGGTTGTCCACGTCTGAGGAGCAACGTGTCAGGCAACTTGTCAGTGATGTTGAGTTGGGTGACCGCCGTCCTTCGCAGTTTTTACGTTATCTTAGATCGTTGGCAGGAAAAACCCTCACTGATGAAAATTTGCTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCAGAACTCTCGCTGGACAAAGTCGCTGAGCTAGCGAACAAAATTTTGGAAGTTTCGCCTGGTATGGTCGCACCTCATTCATCTGCTGTTTTCTCAGCATGCACGTCTGCAGTCTCACCCCCTTCGTTAGAAGATATCACACGGCGTCTGGATGAGGTCACGCGTCAGCTTGCTGTGCTTACTGCAGAGCGCGGTAGAAATAGGACCCGGGATTTCTCAAACCAGCGACGACGCTCACAAACGCCTGATACCGTTTGGCATTCCGAGAAACGTTTACCGGTGTGA
Protein
MEANEQLVREGNTLLQEQNAILKAELQKLKMQGIDKTDPPPTDPLFPQPTSVCRVAIKLPPFWPDRPAIWFAQVEAQFSISGISADRTKFNYVIAQLDTRVIGEVEDIILQPSPEDKYGRLKSELIRRLSTSEEQRVRQLVSDVELGDRRPSQFLRYLRSLAGKTLTDENLLRQLWMRRLPQHLQAILAAQSELSLDKVAELANKILEVSPGMVAPHSSAVFSACTSAVSPPSLEDITRRLDEVTRQLAVLTAERGRNRTRDFSNQRRRSQTPDTVWHSEKRLPV

Summary

EMBL
KL363297    KFD48322.1    KL367555    KFD64488.1    KL367519    KFD66949.1    + More
LBMM01012479    KMQ86203.1    KQ980726    KYN14011.1    GEZM01017686    JAV90494.1    KQ980296    KYN16851.1    KQ981018    KYN10257.1    LBMM01013103    KMQ85816.1    NEVH01000707    PNF43124.1    KL363185    KFD58079.1    NWSH01002598    PCG67884.1    NEVH01013558    PNF28672.1    NEVH01011195    PNF31836.1    NEVH01003759    PNF40011.1    NEVH01014357    PNF27922.1    NEVH01024424    PNF17276.1    NEVH01019603    PNF22346.1    GL447057    EFN86960.1    KQ979048    KYN23218.1    MRZV01001127    MRZV01000236    PIK40395.1    PIK54731.1    MRZV01000025    PIK61772.1    LBMM01012075    KMQ86422.1    KQ414987    KOC58988.1    AAGJ04133382    NEVH01023981    PNF17578.1    NEVH01026394    PNF14234.1    NEVH01026435    PNF14140.1    ACPB03037918    KK111495    EZA46390.1    ODYU01011787    SOQ57731.1    NWSH01000267    PCG77880.1    LBMM01012923    LBMM01012917    KMQ85926.1    KMQ85930.1    MRZV01000203    PIK55728.1    GEZM01036621    JAV82564.1    AAGJ04150373    MRZV01002078    PIK34788.1    MRZV01001674    PIK36447.1    GFWV01018519    MAA43247.1    CH905996    KPU81830.1    CH902629    KPU75574.1    AAGJ04172791    AAGJ04135261    KQ435204    KZC15052.1    AAGJ04112098    GBHO01008962    JAG34642.1    KQ971745    KYB24749.1    JXUM01031600    KQ560927    KXJ80313.1    CH902689    KPU72637.1    KQ973343    KXZ75568.1    GG695519    EFA13383.1    JXUM01049417    KQ561603    KXJ78027.1    JXUM01111110    KQ565471    KXJ70931.1   
Pfam
PF00498   FHA        + More
PF00078   RVT_1
PF17919   RT_RNaseH_2
PF17921   Integrase_H2C2
PF00665   rve
PF10551   MULE
PF00077   RVP
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR000253   FHA_dom       
IPR008984   SMAD_FHA_dom_sf       
IPR001969   Aspartic_peptidase_AS       
IPR000477   RT_dom       
IPR034132   RP_Saci-like       
IPR041588   Integrase_H2C2       
IPR041577   RT_RNaseH_2       
IPR036397   RNaseH_sf       
IPR001584   Integrase_cat-core       
IPR001995   Peptidase_A2_cat       
IPR012337   RNaseH-like_sf       
IPR018289   MULE_transposase_dom       
IPR018061   Retropepsins       
SUPFAM
SSF50630   SSF50630        + More
SSF49879   SSF49879       
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
285
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.04006
outside
1  -  285
 
 

Population Genetic Test Statistics

Pi
294.261001
Theta
20.553696
Tajima's D
2.957447
CLR
0.096752
CSRT
0.975351232438378
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号