SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08305
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.059
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGCTATGCGGATGACAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGCGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTGCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCAAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAAGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTCTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTACTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MTINAGVPQGSVLSPTLFILYINDMLSIDGMHCYADDSTGDARYIGHQSLSRSAVQERRSKLVSEVENSLGRVCEWGELNLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQKRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    RSAL01000109    RVE47192.1    + More
RSAL01002067    RVE40593.1    RSAL01000487    RVE41561.1    RSAL01000422    RVE41792.1    RSAL01000072    RVE49051.1    RSAL01000002    RVE54942.1    RSAL01003136    RVE40332.1    RSAL01000210    RVE44225.1    RSAL01002827    RVE40408.1    RSAL01000090    RVE48098.1    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    RSAL01000164    RVE45343.1    RSAL01000007    RVE54134.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    GFAC01000919    JAT98269.1    GEFM01002394    JAP73402.1    GEGO01001118    JAR94286.1    GEFM01002324    JAP73472.1    GEGO01004630    JAR90774.1    GFAA01002657    JAU00778.1    GFAA01002514    JAU00921.1    GBIH01002577    JAC92133.1    GFAA01002479    JAU00956.1    GFAC01005646    JAT93542.1    GEGO01003312    JAR92092.1    GDRN01111277    JAI56804.1    GEFM01006417    JAP69379.1    GEFM01002419    JAP73377.1    GEFM01006421    JAP69375.1    GEGO01004433    JAR90971.1    GEGO01002473    JAR92931.1    GFAC01005665    JAT93523.1    FLMD02000154    SCV66010.1    GFAA01002385    JAU01050.1    GEFM01005882    JAP69914.1    GDRN01111334    JAI56796.1    MRZV01000639    PIK46517.1    GEGO01004295    JAR91109.1    GEGO01003518    JAR91886.1    LSMT01000297    PFX20951.1    NSIT01000412    PJE77717.1    NSIT01000218    PJE78268.1    GEGO01003111    JAR92293.1    FLMD02000280    SCV66640.1    GFAA01000066    JAU03369.1    NSIT01000271    PJE78081.1    GEGO01007187    JAR88217.1    GEGO01003794    JAR91610.1    GFAA01003161    JAU00274.1    GFAC01005670    JAT93518.1    GEGO01004056    JAR91348.1    NSIT01000239    PJE78188.1    GADI01001229    JAA72579.1    LSMT01000588    PFX15986.1    GFAC01000861    JAT98327.1    GEGO01007438    JAR87966.1    GEGO01004248    JAR91156.1    GFAC01007905    JAT91283.1    KZ505886    PKU43598.1    GEGO01002025    JAR93379.1    NSIT01000164    PJE78524.1    GFAA01002726    JAU00709.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF04939   RRS1
PF01873   eIF-5_eIF-2B
PF08159   NUC153
PF00458   WHEP-TRS
PF03372   Exo_endo_phos
PF01425   Amidase
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR028082   Peripla_BP_I       
IPR007023   Ribosom_reg       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR036291   NAD(P)-bd_dom_sf       
IPR002347   SDR_fam       
IPR020904   Sc_DH/Rdtase_CS       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR000120   Amidase       
IPR036928   AS_sf       
IPR023631   Amidase_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF53822   SSF53822       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF51735   SSF51735       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF75304   SSF75304       
Gene 3D

Ontologies

Topology

Length:
329
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.7135
Exp number, first 60 AAs:
0.71344
Total prob of N-in:
0.04468
outside
1  -  329
 
 

Population Genetic Test Statistics

Pi
29.633994
Theta
30.831558
Tajima's D
-0.184479
CLR
0.098275
CSRT
0.32098395080246
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号