SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08244
Pre Gene Modal
BGIBMGA009452
Annotation
PREDICTED:_multidrug_resistance_protein_homolog_49-like_[Bombyx_mori]
Full name
Multidrug resistance protein homolog 49      
Alternative Name
P-glycoprotein 49
Location in the cell
PlasmaMembrane   Reliability : 2.735
 

Sequence

CDS
ATGAATTTCGCCACCAAGGTCTCTGATGACTTGGAGAAGTTTCGCGAGGGTATAGGTGAGAAAGTCCCCATGCTCATCTATCTGGTGATGTCCTTTGTGACCGCTGTCATTATCTCGTTCGTGTATGGCTGGGAGCTCACGCTGGTCATTCTGTCTTGTACCCCGGTGGTGATCGCAACAACCGCTATAGTTGCAAAGGTGCAGTCATCGCTGACGACGCAAGAGCTGAAAGCCTATAGTGTGGCTGGTATCGTGGCTGAAGAGGTTCTGTCTTCAATCAGAACTGTCGTTGCTTTCGGAGGCGAAGAGAAAGAAATTAAAAGGTACAGCGTCCGCTTGGAGCCGGCGAACAAGATGGGGACACGTAAAGGAATATTTTCGGGCTTCGGAAGCGGGGTCATGTGGCTCATTATATACGGGACATACGCGCTGTCCTTCTGGTACGGAGTCGGCCTCATCCTGAAGTCTCGCCACCAGGAAACGCCTGTGTACACTCCAGCTGTGTTGATGATTATTTTCTTCAGTGTACTCCAAGGGGCTCAGAACGTTGGTCTTACCGCTCCTCATTTAGAGGCCATAGCGAACGCGCGAGCTTCTGCGGCCTCCGTCTATGCCGTCATCGATAGGAAACCGACTATTGACAGTCTCTCCACGGAAGGCGCCAAACCAGAGTTCAAGGGAGACCTGGAACTGGAAGACGTGGTCTTTAGATATCCGGCGAGAGCGGATGTGCAGGTTCTCAATGGATTAAATCTGAAAATAAACGAGAACGAAACGATAGCGCTGGTGGGTCCGAGCGGCTGCGGTAAGTCCACGGTCCTGCAGCTCTTACAGAGGATGTACGACCCCGACCAGGGCTCCGTGAGGGCCAGCGGCCATGACTTGCGGACCATGAACGTGAGGCACCTCAGAAATCACATCGCTGTCGTCGGCCAAGAACCAGTGCTGTTCGCGGGGACCATCAAAGAGAATATCCGAATGAGCAATCCATCTTGCACTGATGATGAGGTCATCGTAGCCGCTAAACAAGCTTACTGCCATGATTTCATAAGGAAATTGCCGGATGGCTACGACACGCCCATAGGCGAGCGCGGCGCCCAGCTCTCCGGCGGACAGAAGCAGCGCATCGCCATAGCTCGCGCGCTGGTGCGGCGCCCCAAGCTGCTGCTGCTGGACGAGGCCACGTCGGCGCTGGACTCGCACAGCGAGGCCAAGGTGCAGCGCGCGCTGGACGCCGCCGCGCACGGACGCACCACCGTCATGGTCTCGCACAGGTACATCTTTTTTTAA
Protein
MNFATKVSDDLEKFREGIGEKVPMLIYLVMSFVTAVIISFVYGWELTLVILSCTPVVIATTAIVAKVQSSLTTQELKAYSVAGIVAEEVLSSIRTVVAFGGEEKEIKRYSVRLEPANKMGTRKGIFSGFGSGVMWLIIYGTYALSFWYGVGLILKSRHQETPVYTPAVLMIIFFSVLQGAQNVGLTAPHLEAIANARASAASVYAVIDRKPTIDSLSTEGAKPEFKGDLELEDVVFRYPARADVQVLNGLNLKINENETIALVGPSGCGKSTVLQLLQRMYDPDQGSVRASGHDLRTMNVRHLRNHIAVVGQEPVLFAGTIKENIRMSNPSCTDDEVIVAAKQAYCHDFIRKLPDGYDTPIGERGAQLSGGQKQRIAIARALVRRPKLLLLDEATSALDSHSEAKVQRALDAAAHGRTTVMVSHRYIFF

Summary

Catalytic Activity
ATP + H(2)O + xenobiotic(Side 1) = ADP + phosphate + xenobiotic(Side 2).
Similarity
Belongs to the ABC transporter superfamily. ABCB family. Multidrug resistance exporter (TC 3.A.1.201) subfamily.
Keywords
ATP-binding   Complete proteome   Glycoprotein   Membrane   Nucleotide-binding   Polymorphism   Reference proteome   Repeat   Translocase   Transmembrane   Transmembrane helix   Transport  
Feature
chain  Multidrug resistance protein homolog 49
EC Number
7.6.2.2
EMBL
BABH01023141    BABH01023142    BABH01023143    BABH01023144    KQ459986    KPJ18849.1    + More
KQ458751    KPJ05317.1    RSAL01000021    RVE52406.1    AGBW02012702    OWR44581.1    HQ116792    ADV76537.1    NWSH01000813    PCG74082.1    KZ149927    PZC77504.1    KQ434778    KZC04441.1    ADTU01001125    GL888217    EGI64783.1    GL443280    EFN62270.1    PYGN01001855    PSN32510.1    LBMM01001080    KMQ96965.1    QOIP01000012    RLU15877.1    KK107488    EZA49880.1    LK392613    CDS25229.1    KQ981855    KYN34821.1    KQ980989    KYN10498.1    GBYB01010488    JAG80255.1    JXUM01038032    JXUM01038033    KQ561151    KXJ79549.1    CVRI01000043    CRK95982.1    AXCM01001297    ATLV01024094    KE525349    KFB50603.1    CH477659    EAT37643.1    KQ414636    KOC67015.1    AAAB01008960    EAA11754.3    APCN01001536    AXCN02000366    ADMH02001746    ETN61204.1    DS232633    EDS44274.1    GFDL01005636    JAV29409.1    JRES01000780    KNC28376.1    NEVH01009768    PNF32772.1    CH916367    EDW01718.1    CCAG010007476    CCAG010007477    JXJN01021173    CH940648    EDW59960.2    CH933808    EDW08452.1    GAMC01018075    GAMC01018073    JAB88482.1    CH963846    EDW72340.2    GAKP01021334    JAC37618.1    GAKP01021335    JAC37617.1    CM000362    EDX06860.1    GDHF01007029    JAI45285.1    KA644629    AFP59258.1    GBXI01010353    JAD03939.1    CH902619    EDV36373.1    UFQT01000131    SSX20626.1    GDHF01018836    JAI33478.1    GDHF01026669    JAI25645.1    GDHF01000751    JAI51563.1    UFQT01000028    SSX18184.1    CP012524    ALC42337.1    OUUW01000001    SPP75152.1    CM000158    EDW90685.1    CM002911    KMY93381.1    KF293379    AIA09025.1    CH480816    EDW47652.1    CH954179    EDV56231.1    M59076    AE013599    AY058791    BT044206    BT081353    CM000071    EAL25242.2    CH479181    EDW32137.1    KF293375    AIA09021.1    KF293376    AIA09022.1    AJWK01001744    GDRN01078022    JAI62650.1    BC107560    AAI07561.1    AABR07059500    AABR07059501    AABR07059502    AABR07059503    AABR07072972    AC133679    AF286167    AAK83023.2    BC154556    AAI54557.1    AGCU01060446    AGCU01060447    AGCU01060448    AGCU01060449    KF906269    AHK05634.1    GDIP01120472    JAL83242.1   
Pfam
PF00005   ABC_tran        + More
PF00664   ABC_membrane
PF00017   SH2
Interpro
IPR003439   ABC_transporter-like        + More
IPR017871   ABC_transporter_CS       
IPR039421   Type_I_exporter       
IPR011527   ABC1_TM_dom       
IPR027417   P-loop_NTPase       
IPR036640   ABC1_TM_sf       
IPR003593   AAA+_ATPase       
IPR036860   SH2_dom_sf       
IPR000980   SH2       
IPR030275   MDR3       
SUPFAM
SSF52540   SSF52540        + More
SSF90123   SSF90123       
SSF55550   SSF55550       
Gene 3D
PDB
6QEX     E-value=4.24681e-120,     Score=1104

Ontologies

Topology

Subcellular location
Membrane  
Length:
429
Number of predicted TMHs:
4
Exp number of AAs in TMHs:
78.53628
Exp number, first 60 AAs:
33.41281
Total prob of N-in:
0.52916
POSSIBLE N-term signal
sequence
outside
1  -  21
TMhelix
22  -  44
inside
45  -  45
TMhelix
46  -  65
outside
66  -  131
TMhelix
132  -  154
inside
155  -  160
TMhelix
161  -  180
outside
181  -  429
 
 

Population Genetic Test Statistics

Pi
160.918079
Theta
161.962617
Tajima's D
0.954968
CLR
0.127501
CSRT
0.653267336633168
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号