SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08221
Annotation
reverse_transcriptase_[Bombyx_mori]
Full name
Fatty acyl-CoA reductase      
Location in the cell
Mitochondrial   Reliability : 3.638
 

Sequence

CDS
ATGCTGGGAGTCTTCAACAGAGCGAAGTGGTACTTCACGCTTGGACAAAGACATTTGCTTTACAAAGCACGGGTCCGGCCTCACGTGGAGTACTACTCCCATCTCTGGGCCGGGGCTCTGAAATACCAGCTACTTCCATTTGACTTCATACAGAAGAAGGCCGTTCGGATTATCGATAATCCCATTTTCATGGATCGTTTGGAATCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTACATGGGGCACGTTTCCATAGATATTTTTGCCACGTACCATCCGGCTTTGGAATGTGCTCCCCTCTAAAACAAGCACGCACAGAATACGCGTAA
Protein
MLGVFNRAKWYFTLGQRHLLYKARVRPHVEYYSHLWAGALKYQLLPFDFIQKKAVRIIDNPIFMDRLESLGLRRDFGSLCILYRMLHGARFHRYFCHVPSGFGMCSPLKQARTEYA

Summary

Description
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols.
Catalytic Activity
a long-chain fatty acyl-CoA + 2 H(+) + 2 NADPH = a long-chain primary fatty alcohol + CoA + 2 NADP(+)
Similarity
Belongs to the fatty acyl-CoA reductase family.
EC Number
1.2.1.84
EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    RSAL01000487    RVE41561.1    + More
RSAL01000109    RVE47192.1    RSAL01002067    RVE40593.1    RSAL01000422    RVE41792.1    RSAL01000164    RVE45343.1    RSAL01002868    RVE40398.1    RSAL01002827    RVE40408.1    RSAL01000090    RVE48098.1    RSAL01000280    RVE43066.1    RSAL01000253    RVE43469.1    RSAL01000002    RVE54942.1    RSAL01003136    RVE40332.1    RVE55041.1    RVE55094.1    RSAL01000210    RVE44225.1    RSAL01000007    RVE54134.1    DPOC01000269    HCX22453.1    ODYU01002162    SOQ39302.1    RSAL01000072    RVE49051.1    ODYU01007424    SOQ50185.1    LWDP01000391    ORD92879.1    GDRN01105059    JAI57791.1    ODYU01007423    SOQ50184.1    AMCI01002135    EJX03495.1    FM995623    CAX36785.1    ODYU01000366    SOQ35027.1    QRBI01000102    RMC16528.1    HAAD01001474    CDG67706.1    AGCU01012855    IACL01033656    LAB02935.1    AGCU01032078    QRBI01000116    RMC08902.1    QRBI01000106    RMC12215.1    AGCU01063261    AGCU01000442    AGCU01203047    AGCU01033893    AGCU01066665    AGCU01035999    KZ506506    PKU39369.1    KL225273    KFW70433.1    AGCU01082246    AGCU01168699    AGCU01122093    RSAL01000157    RVE45592.1    KZ507616    PKU36473.1    KK501890    KFP18764.1    AGCU01040360    AAWZ02024500    AGCU01165999    KK520248    KFP66142.1    KK500813    KFP10422.1    QRBI01000136    RMC01723.1    KZ505800    PKU44826.1    KZ505829    PKU44419.1    QRBI01000113    RMC09825.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF01873   eIF-5_eIF-2B
PF15613   WSD
PF04939   RRS1
PF07993   NAD_binding_4
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF08159   NUC153
PF12335   SBF2
PF03456   uDENN
PF02141   DENN
PF15008   DUF4518
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR028941   WHIM2_dom       
IPR007023   Ribosom_reg       
IPR036291   NAD(P)-bd_dom_sf       
IPR013120   Male_sterile_NAD-bd       
IPR026055   FAR       
IPR028082   Peripla_BP_I       
IPR002347   SDR_fam       
IPR020904   Sc_DH/Rdtase_CS       
IPR013083   Znf_RING/FYVE/PHD       
IPR036987   SRA-YDG_sf       
IPR018957   Znf_C3HC4_RING-type       
IPR015947   PUA-like_sf       
IPR017907   Znf_RING_CS       
IPR001841   Znf_RING       
IPR003105   SRA_YDG       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR030564   Myotubularin_fam       
IPR005113   uDENN_dom       
IPR022096   SBF1/SBF2       
IPR030567   MTMR13       
IPR037516   Tripartite_DENN       
IPR001194   cDENN_dom       
IPR005112   dDENN_dom       
IPR038751   Int8       
IPR026698   UPF_C3orf38       
IPR032710   NTF2-like_dom_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF51735   SSF51735       
SSF53822   SSF53822       
SSF88697   SSF88697       
SSF50978   SSF50978       
SSF54427   SSF54427       

Ontologies

Topology

Subcellular location
Nucleus  
Length:
116
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04681
Exp number, first 60 AAs:
0.02412
Total prob of N-in:
0.23330
outside
1  -  116
 
 

Population Genetic Test Statistics

Pi
104.872419
Theta
89.957692
Tajima's D
0.50352
CLR
24.748276
CSRT
0.517174141292935
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号