Gene

KWMTBOMO08100  Validated by peptides from experiments

Pre Gene Modal

BGIBMGA001106

Annotation

ribosomal_protein_L21_[Bombyx_mori]

Location

Bomo_Chr13(-):15952645-15955376      View in EpiBrowser

Full name

60S ribosomal protein L21       + More
60S ribosomal protein L21-B      
60S ribosomal protein L21-A      

Alternative Name

Large ribosomal subunit protein eL21
Large ribosomal subunit protein eL21-A
Large ribosomal subunit protein eL21-B

Location in the cell

Cytoplasmic   Reliability : 1.895 Mitochondrial   Reliability : 1.368 Nuclear   Reliability : 1.504

CDS

ATGACGAACTCCAAGGGTTACCGCCGCGGCACCAGGGACTTGTTCGCTCGCAGGTTCCGCACACATGGAACTATTCCGCTCTCCACGTACATGAAAGTGTACAAAGTTGGAGACATTGTAGACATCAGAGGCAATGGTGCAGTTCAAAAGGGTATGCCACACAAAGTATACCATGGAAAGACAGGTCGCGTGTACAACGTGACTGCTCATGCTCTCGGTGTGATTGTCAACAAGCGTGTTCGCGGAAGGATTATACCGAAGCGCATCAATATCCGTGTTGAGCATGTCAAGCACTCCAAGTGCAGACAAGACTTCCTTAAGAGAGTCAAAGAGAATGAGAGGCTACTGAAGGAAGCCAAGGCTGCCGGCAAGACCGTCAACCTGAAGAGACAGCCAGCTCCCCCTAAAGCTGCCCACATCGTCAGTGGAACTGAGAAACCCGTCTTACTTGCGCCTATCCCATACGAATTCGTAGCGTAA

Protein

MTNSKGYRRGTRDLFARRFRTHGTIPLSTYMKVYKVGDIVDIRGNGAVQKGMPHKVYHGKTGRVYNVTAHALGVIVNKRVRGRIIPKRINIRVEHVKHSKCRQDFLKRVKENERLLKEAKAAGKTVNLKRQPAPPKAAHIVSGTEKPVLLAPIPYEFVA

Description

Component of the large ribosomal subunit.
Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel.

Subunit

Component of the large ribosomal subunit.
Component of the large ribosomal subunit (LSU). Mature yeast ribosomes consist of a small (40S) and a large (60S) subunit. The 40S small subunit contains 1 molecule of ribosomal RNA (18S rRNA) and 33 different proteins (encoded by 57 genes). The large 60S subunit contains 3 rRNA molecules (25S, 5.8S and 5S rRNA) and 46 different proteins (encoded by 81 genes) (PubMed:9559554, PubMed:22096102).

Miscellaneous

There are two genes for L21 in S.pombe.
There are 2 genes for eL21 in yeast.
Present with 66400 molecules/cell in log phase SD medium.

Similarity

Belongs to the eukaryotic ribosomal protein eL21 family.

Keywords

3D-structure   Complete proteome   Cytoplasm   Endoplasmic reticulum   Reference proteome   Ribonucleoprotein   Ribosomal protein   Direct protein sequencing   Disease mutation   Hypotrichosis   Polymorphism   Isopeptide bond   Ubl conjugation  

Feature

chain  60S ribosomal protein L21
sequence variant  In dbSNP:rs17085349.

Uniprot

P49666   P46778   A5JSS2   Q6QN05   P20280   O09167   + More
A0A060TF16   P49667   A0A1Y2C6Z5   A0A1E4SCS3   S9PVW4   A0A1E4RCV0   A0A1E4RPX1   A0A061B234   A0A1E4TMP9   A0A0H5C392   G0S0Z3   A0A1G4JMF1   A0A397JS32   G3B1K3   A0A1G4MI83   A0A1D8PGY0   A0A0V1PY50   A0A0V1Q552   A0A077X432   S9XCT4   A0A2Z6SFJ8   A0A0W0CXB7   Q6FJG3   S9QW06   S9VWQ5   Q6BUU5   A0A068RIP9   O42706   A0A068SAB2   H8WXD6   Q9UUC1   A0A1X2G228   U9TA68   A0A2I1EVZ9   A0A1Q3A8C2   A0A1Q2ZTX5   A0A1G4JDL8   P34334   A0A0J9XG52   H2AZR1   G8YTQ1   G8BDY0   G8ZP78   A0A1L0C0D6   G0VCI5   N1P6X8   D3UET4   G2W9J2   B3LMX1   Q02753   A0A0C9MFL3   A0A168LX33   S2JYJ1   A0A1S7HJ83   A0A1L0BY43   A0A1R0H5B2   A0A372RS20   S2JPB6   A0A1E3QBG7   A0A1R1YT60   A0A0C4ED56   A0A0C7N8Z8   A0A1A0H5F5   G3ALH4   A0A0A8LAF7   N1NVX6   A0A0L8VG16   C8ZIV1   G2WPA2   B3LKZ1   Q12672   A0A421JUT6   A0A1X2IS07   A0A421JQ11   A0A0J9X376   B6JXL3   J7QZH9   A0A1L0DF75   A0A1S7H934   A3LRQ7   A0A1X2IQ55   A5DLI6   A7TGL8   A0A397USQ2   A0A1C7MZ43   A0A1G4J513   A0A1G4KF49   A0A0L8RM14   A3LVV1   H0H237   C5M607   A0A0L0S805   A0A0L8VVH5   A0A2H3J9S8  

Pubmed

8672129    24930395    7772601    7581362    11875025    15489334    + More
7951316    9582194    12962325    21269460    21412954    22814378    24524803    25944712    23636399    25957688    25901680    2751657    21183079    27535936    21511999    25103752    28385833    26150016    21784248    21788494    15123810    17419877    24025428    15229592    11859360    22563396    24277808    30271968    29355972    7906398    9851916    22123960    19465905    22192698    22448915    19805302    21900213    8428379    7813418    24374639    7871891    8346681    9559554    10601260    14562095    11701127    14976550    21109664    22096102    27343289    9169875    14562106    22106047    17334359    17494770    26269586    22136070    22745431   

EMBL

AEMK02000075    KU891824    F14727    AMR57225.1    X89401    U14967    + More
AB061826    BC001603    BC007505    BC062981    BC070184    BC070323    BC070330    U25789    L38826    AB007176    EF564260    AY533214    M27905    X15216    U93863    HG937694    CDP37776.1    Z16079    L03714    MCGO01000027    ORY42762.1    ORY42793.1    KV453915    KV453909    ODV77266.1    ODV82008.1    KE503207    EPX72117.1    KV454545    ODV65053.1    KV454538    ODV69322.1    LK052891    MPUK01000002    CDR41057.1    ONH68475.1    KV454097    ODV93024.1    CDQK01000003    KV453926    CEP22495.1    ODV75351.1    GL988039    EGS22703.1    LT598465    SCU91812.1    PQFF01000010    RHZ89698.1    GL996515    GL996510    EGV64466.1    EGV66854.1    LT598486    SCW03611.1    CP017624    AOW27410.1    LMYN01000061    KSA01182.1    LMYN01000007    KSA03646.1    LK023314    LK023317    LK023386    CDS04035.1    CDS05827.1    CDS14249.1    KE546990    EPY51656.1    BEXD01004237    GBC08672.1    LLZZ01000117    KTB04211.1    CR380959    CAG62607.1    KE503208    EPX70500.1    EPY52083.1    CR382134    CR382135    CAG85171.1    CAG86087.2    CBTN010000003    CDH49580.1    CU329670    AB010901    CBTN010000054    CDH58191.1    HE681719    CCG21442.1    CU329671    MCGT01000074    ORX42174.1    KE392318    BDIQ01000197    AUPC02000229    ESA03223.1    GBC53645.1    POG64849.1    LLXJ01000627    LLXH01000760    LLXL01001135    LLXK01000940    LLXI01000633    PKC07587.1    PKC63227.1    PKK66162.1    PKY26301.1    PKY48357.1    BDGX01000032    GAV51995.1    BDGX01000003    GAV46972.1    LT598472    SCU88031.1    FO080531    CCBN010000015    CDO56364.1    HE650825    HE650829    CCF58241.1    CCF59861.1    FO082059    FO082058    CCE72741.1    CCE73302.1    HE605206    CCE43477.1    HE616743    CCE90422.1    LT635767    SGZ56170.1    HE576753    HE576754    CCC68297.1    CCC69195.1    CM001523    EIW12124.1    FN393060    CBK39264.1    DG000038    GAA21735.1    CH408048    EDV11924.1    M86408    Z36059    Z21487    U02073    BK006936    DF836302    GAN01897.1    AMYB01000004    AMYB01000003    OAD04067.1    OAD04953.1    OAD05083.1    KE124172    KE124026    EPB81470.1    EPB84885.1    CP019494    AQZ13099.1    LT635760    SGZ56171.1    LSSL01000509    OLY84402.1    QKKE01000016    RGB42924.1    KE124039    EPB84438.1    KV454292    ODQ74482.1    LSSM01000086    OMJ30079.1    ADBL01002380    GL876975    KLU90798.1    LN736363    CEP61902.1    LXTC01000007    OBA19153.1    GL996501    EGW32995.1    EGW33217.1    CCBQ010000043    CDO95155.1    CM001537    EIW07033.1    LIIL01000028    KOH47298.1    FN394217    CAY86882.1    DG000052    GAA26895.1    CH408046    EDV11139.1    U41849    BK006949    NSGQ01000004    RLV95760.1    MCGE01000011    MCGE01000005    ORZ16328.1    ORZ16503.1    ORZ21289.1    NSGQ01000016    RLV93376.1    CCBN010000002    CDO51890.1    KE651166    EEB05157.1    HE978314    CCK67880.1    CCK68043.1    SGZ55196.1    SGZ55325.1    CP019490    AQZ09517.1    CP000497    ABN65429.1    MCGE01000006    ORZ20398.1    CH408159    EDK40039.1    DS480415    DS480387    EDO16881.1    EDO18625.1    QKWP01000944    RIB13224.1    LUGH01001098    OBZ81679.1    LT598454    SCU84881.1    LT598480    SCV03084.1    JMCK01000004    KOH00505.1    CP000499    ABN67183.1    AGVY01000382    EHM99912.1    GG692396    EER34427.1    GG745333    KNE58632.1    LIIL01000014    KOH52212.1    KB467831    PCH34418.1   

Proteomes

UP000008227    UP000005640    UP000291000    UP000002494    UP000000589    UP000193642    + More
UP000094285    UP000016088    UP000095085    UP000189513    UP000094236    UP000038830    UP000094389    UP000008066    UP000191024    UP000266861    UP000000707    UP000190831    UP000000559    UP000054251    UP000015464    UP000247702    UP000054886    UP000002428    UP000000599    UP000027586    UP000002485    UP000005018    UP000242146    UP000018888    UP000236242    UP000232688    UP000232722    UP000233469    UP000234323    UP000187013    UP000190866    UP000001940    UP000242525    UP000005220    UP000005222    UP000005221    UP000005627    UP000182259    UP000001640    UP000013192    UP000000286    UP000001608    UP000008335    UP000002311    UP000053815    UP000077051    UP000014254    UP000190375    UP000182334    UP000187455    UP000263633    UP000094385    UP000187429    UP000011715    UP000054304    UP000092555    UP000000709    UP000031516    UP000037662    UP000285775    UP000193560    UP000001744    UP000006310    UP000002258    UP000001997    UP000000267    UP000266673    UP000093000    UP000190274    UP000191144    UP000050240    UP000009009    UP000002037    UP000054350    UP000218811   

PRIDE

P49666    P46778    A5JSS2    Q6QN05    P20280    O09167    + More
P49667    O42706    Q9UUC1    U9TA68    P34334    Q02753    Q12672   

Pfam

PF01157   Ribosomal_L21e        + More
PF01479   S4

Interpro

IPR008991   Translation_prot_SH3-like_sf        + More
IPR018259   Ribosomal_L21e_CS       
IPR001147   Ribosomal_L21e       
IPR036948   Ribosomal_L21_sf       
IPR022801   Ribosomal_S4/S9       
IPR001912   Ribosomal_S4/S9_N       
IPR002942   S4_RNA-bd       
IPR018079   Ribosomal_S4_CS       
IPR036986   S4_RNA-bd_sf       
IPR005710   Ribosomal_S4/S9_euk/arc       

SUPFAM

SSF50104   SSF50104       

Gene 3D

2.30.30.70     3.10.290.10    

CDD

cd00165  S4

ProteinModelPortal

P49666   P46778   A5JSS2   Q6QN05   P20280   O09167   + More
A0A060TF16   P49667   A0A1Y2C6Z5   A0A1E4SCS3   S9PVW4   A0A1E4RCV0   A0A1E4RPX1   A0A061B234   A0A1E4TMP9   A0A0H5C392   G0S0Z3   A0A1G4JMF1   A0A397JS32   G3B1K3   A0A1G4MI83   A0A1D8PGY0   A0A0V1PY50   A0A0V1Q552   A0A077X432   S9XCT4   A0A2Z6SFJ8   A0A0W0CXB7   Q6FJG3   S9QW06   S9VWQ5   Q6BUU5   A0A068RIP9   O42706   A0A068SAB2   H8WXD6   Q9UUC1   A0A1X2G228   U9TA68   A0A2I1EVZ9   A0A1Q3A8C2   A0A1Q2ZTX5   A0A1G4JDL8   P34334   A0A0J9XG52   H2AZR1   G8YTQ1   G8BDY0   G8ZP78   A0A1L0C0D6   G0VCI5   N1P6X8   D3UET4   G2W9J2   B3LMX1   Q02753   A0A0C9MFL3   A0A168LX33   S2JYJ1   A0A1S7HJ83   A0A1L0BY43   A0A1R0H5B2   A0A372RS20   S2JPB6   A0A1E3QBG7   A0A1R1YT60   A0A0C4ED56   A0A0C7N8Z8   A0A1A0H5F5   G3ALH4   A0A0A8LAF7   N1NVX6   A0A0L8VG16   C8ZIV1   G2WPA2   B3LKZ1   Q12672   A0A421JUT6   A0A1X2IS07   A0A421JQ11   A0A0J9X376   B6JXL3   J7QZH9   A0A1L0DF75   A0A1S7H934   A3LRQ7   A0A1X2IQ55   A5DLI6   A7TGL8   A0A397USQ2   A0A1C7MZ43   A0A1G4J513   A0A1G4KF49   A0A0L8RM14   A3LVV1   H0H237   C5M607   A0A0L0S805   A0A0L8VVH5   A0A2H3J9S8  

PDB

4V6W     E-value=1.13841e-61,     Score=594

KEGG

692697    K02889 large subunit ribosomal protein L21e | (RefSeq) RpL21; ribosomal protein L21

PATHWAY

03010    Ribosome - Bombyx mori (domestic silkworm)

GO

GO:0006412   GO:0003735   GO:0005783   GO:0022625   GO:0006614   GO:0000184   GO:0003723   GO:0006413   GO:0016020   GO:0005829   GO:0019083   GO:0005840   GO:0002181   GO:0019843   GO:0015935   GO:0005622   GO:0015934   GO:0015914   GO:0046872   GO:0016876   GO:0043039  

PANTHER

PTHR20981   PTHR11831  

Subcellular location

Cytoplasm   Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (PubMed:24930395).   With evidence from 4 publications.
Cytosol   Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (PubMed:24930395).   With evidence from 4 publications.
Endoplasmic reticulum   Detected on cytosolic polysomes (By similarity). Detected in ribosomes that are associated with the rough endoplasmic reticulum (PubMed:24930395).   With evidence from 4 publications.

Length:

159

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.04062

Exp number, first 60 AAs:

0.00971

Total prob of N-in:

0.45565

outside

1  -  159

 

 

Pi

5.445714

Theta

12.309493

Tajima's D

-1.52642

CLR

3.040088

CSRT

0.0516474176291185

Interpretation

Uncertain