SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08086
Annotation
PREDICTED:_uncharacterized_protein_LOC106110672?_partial_[Papilio_polytes]
Location in the cell
Cytoplasmic   Reliability : 2.267
 

Sequence

CDS
ATGGATGAGAAATTAAAACCTATTTTAGAGGAAAATAAATACTTAAAATTAAAAGTAGAGAACTTGGAAAAGAAAATCGAAATTTTAGAGAGAGATAAGAAAACTAACAATATAATAATCCATGGATTGACAGAAGACGAGAAATCGACACCCGAGCTTATCGACAAGGTCAAAGATACAATAACAAAAGAATTAGGCATAGCAATCGAAAATTATGAATTCAACAAAATATATCGTATTGGTAAAACAAACAAAGGTAATCCATCAAAGGTAATCCGACCTATACTAATATGCTTGACTACTGGATGGAAAAAAGCGGAAATATTGAAAAATAAGAGAAAGTTAAAAGACCTGCATATCACGGAAGATTACTCTAAAGAAACCTTAGAAAAACGTAAGGCTTTACTACCACAACTCATGGAAGAACGGAGAAAAGATATACACATAGCCACTTTTAACGCAAGATCATTAAGAACTCCTGAAAAACTTCAAGAACTTGAATTAGCTTTATCAGATATAAAATGGGATATAATAGGAATAAGTGAAATGAGAAGATATGGAGAAGGAATTGAAGACTATGGAAACTTTATTTTACACTATAAAGGCGAGACACCAGGGCTCTACGGAGTCGGCTTTCTTGTAAAAAAAGGACTTGCCGAGAAAATAGGAGAAATCAAAGGTGTCTCAGAGAGAATAGCAGTTTTAAACATTGAGTTACCAGTCAAAAATGCTGAAAAATGGTCTATAATTCAAGCTTATTCTCCAACAGAATCGAACAAGAAAGATGACATAAGGAAAATAGAAAAATTCTATGAAGATTTACATCTTACCATTGAAAATTCGCATAAAAATATAATTGTCATGGCAGCTTTTCATGAAACAGTGCTACACTTTAAAAGGTATAGGAAGACGGAAATTGGTAAAGCTATAGGACAAACTTAA
Protein
MDEKLKPILEENKYLKLKVENLEKKIEILERDKKTNNIIIHGLTEDEKSTPELIDKVKDTITKELGIAIENYEFNKIYRIGKTNKGNPSKVIRPILICLTTGWKKAEILKNKRKLKDLHITEDYSKETLEKRKALLPQLMEERRKDIHIATFNARSLRTPEKLQELELALSDIKWDIIGISEMRRYGEGIEDYGNFILHYKGETPGLYGVGFLVKKGLAEKIGEIKGVSERIAVLNIELPVKNAEKWSIIQAYSPTESNKKDDIRKIEKFYEDLHLTIENSHKNIIVMAAFHETVLHFKRYRKTEIGKAIGQT

Summary

Pfam
PF14529   Exo_endo_phos_2
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR027124   Swc5/CFDP2       
IPR036691   Endo/exonu/phosph_ase_sf       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

GO

Topology

Length:
313
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00398
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00998
outside
1  -  313
 
 

Population Genetic Test Statistics

Pi
11.58553
Theta
13.565703
Tajima's D
0
CLR
18.733125
CSRT
0.382230888455577
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号