SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO08079
Annotation
reverse_transcriptase_[Bombyx_mori]
Full name
Odorant receptor      
Location in the cell
Mitochondrial   Reliability : 3.17
 

Sequence

CDS
ATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGGCTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGGTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAGGAGGGCCGTTCGGATTGTCGATAATCCCGGTCTCACGGATCGTTTGGAACCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACTGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGGTCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYWSHLWAGAPKYQLLPFDSIQRRAVRIVDNPGLTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMILASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

Similarity
Belongs to the protein kinase superfamily. Tyr protein kinase family.
Belongs to the insect chemoreceptor superfamily. Heteromeric odorant receptor channel (TC 1.A.69) family.
EMBL
AB126052    BAD86652.1    AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    + More
RSAL01002868    RVE40398.1    RSAL01000164    RVE45343.1    FM995623    CAX36785.1    RSAL01003136    RVE40332.1    RSAL01002827    RVE40408.1    RSAL01000002    RVE54942.1    RVE55041.1    RVE55094.1    RSAL01000422    RVE41792.1    RSAL01000210    RVE44225.1    RSAL01000007    RVE54134.1    RSAL01000072    RVE49051.1    ODYU01007424    SOQ50185.1    ODYU01002162    SOQ39302.1    AMCI01002135    EJX03495.1    RSAL01000058    RVE49758.1    HAAD01001474    CDG67706.1    RSAL01000193    RVE44603.1    LWDP01000391    ORD92879.1    ODYU01000366    SOQ35027.1    GDRN01105059    JAI57791.1    RSAL01000030    RVE51708.1    RSAL01000110    RVE47159.1    DPOC01000269    HCX22453.1    ODYU01004409    SOQ44252.1    ODYU01011959    SOQ58001.1    ODYU01006795    SOQ48973.1    ODYU01007423    SOQ50184.1    RSAL01000390    RVE41999.1    ODYU01003793    SOQ42997.1    MRZV01001153    PIK40187.1    GFAC01000919    JAT98269.1    AAGJ04079835    GFAA01002385    JAU01050.1    GEGO01004630    JAR90774.1    GBZX01002173    JAG90567.1    GEFM01001453    JAP74343.1    MRZV01000414    PIK50568.1    GFAC01000877    JAT98311.1    AAGJ04112043    GFAA01000199    JAU03236.1    GEFH01003922    JAP64659.1    JARK01001381    EYC12952.1    EYC12953.1    GEFM01001613    JAP74183.1    GEFM01002424    JAP73372.1    GEGO01002025    JAR93379.1    GEGO01003312    JAR92092.1    GEFM01002439    JAP73357.1    GFAC01005670    JAT93518.1    KZ505886    PKU43598.1    GBIH01000637    JAC94073.1    GFAA01002657    JAU00778.1    GFAA01002479    JAU00956.1    KL218275    KFP03813.1    KL217824    KFO99526.1    GEFM01002419    JAP73377.1    GEGO01003794    JAR91610.1    GFAA01002660    JAU00775.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF15613   WSD
PF01873   eIF-5_eIF-2B
PF01585   G-patch
PF00086   Thyroglobulin_1
PF08159   NUC153
PF00458   WHEP-TRS
PF02182   SAD_SRA
PF00097   zf-C3HC4
PF07714   Pkinase_Tyr
PF00083   Sugar_tr
PF16030   GD_N
PF02949   7tm_6
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR028941   WHIM2_dom       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR028082   Peripla_BP_I       
IPR036291   NAD(P)-bd_dom_sf       
IPR002347   SDR_fam       
IPR020904   Sc_DH/Rdtase_CS       
IPR036857   Thyroglobulin_1_sf       
IPR000716   Thyroglobulin_1       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR013083   Znf_RING/FYVE/PHD       
IPR036987   SRA-YDG_sf       
IPR018957   Znf_C3HC4_RING-type       
IPR015947   PUA-like_sf       
IPR017907   Znf_RING_CS       
IPR001841   Znf_RING       
IPR003105   SRA_YDG       
IPR000719   Prot_kinase_dom       
IPR008266   Tyr_kinase_AS       
IPR020635   Tyr_kinase_cat_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR011009   Kinase-like_dom_sf       
IPR036259   MFS_trans_sf       
IPR020846   MFS_dom       
IPR005828   MFS_sugar_transport-like       
IPR031986   GD_N       
IPR004117   7tm6_olfct_rcpt       
SUPFAM
SSF56219   SSF56219        + More
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF54928   SSF54928       
SSF53822   SSF53822       
SSF51735   SSF51735       
SSF57610   SSF57610       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF88697   SSF88697       
SSF56112   SSF56112       
SSF103473   SSF103473       

Ontologies

Topology

Subcellular location
Nucleus  
Cell membrane  
Length:
185
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00207
Exp number, first 60 AAs:
0.00072
Total prob of N-in:
0.17975
outside
1  -  185
 
 

Population Genetic Test Statistics

Pi
1.386142
Theta
5.148022
Tajima's D
-1.921997
CLR
7.127271
CSRT
0.0152992350382481
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号