SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07999
Pre Gene Modal
BGIBMGA001013
Annotation
putative_cAMP-dependent_protein_kinase_catalytic_subunit?_partial_[Operophtera_brumata]
Location in the cell
Cytoplasmic   Reliability : 1.895
 

Sequence

CDS
ATGGGGGGCGGCGATAAGATAGACCTTAGCACAACACAATCGGACATAGCCGTTTTACAGGAAAAGGGATTCATACTAGAAAAAGTTATCGGAGAAGGTTCTTACGCTAAGGTTTACAAAGCCACTCATATGGTAGACGAGACCCGGCATTCAATAATGGCCTGTAAAGTCATCGACACAGCTAAGGCGCCCAGGGACTATCTCACAAAGTTCTTGCCTCGCGAGCTAGATGTTCTGATACGCATCAACCACCCTCACATCGTGCACGTGTCCAACATATTTCAACGTCGCGCTAAATACTTTATTTTTTTACGATTTGCTGAAAACGGCGATCTGTTGGACTTTCTCACTCAAAACGGGGCAATACCGGAAAATCAAAGCAGACTGTGGATGCGGCAAATCATATCCGGCCTTCAATACATTCACACAATGAACATAGCTCACAGAGATCTAAAATGCGAAAACGTTTTGGTCACGGCCAATTATAATGTTAAAATAACTGATTTTGGATTTGCACGTAATGTGCGTCAACGAGATAGAGACGTTCTAAGCGAGACGTACTGTGGTTCTCTTTCGTACGCCGCTCCCGAAGTACTAAAGGGGGTGCCTTACATGCCTAAACTGGCCGATATGTGGTCGATCGGCGTTATACTATACACCATGCTCAACAAAGCTTTACCTTTCAACGAAACGTCCGTCAAAAAGCTGTACGAAAAACAGAACTAA
Protein
MGGGDKIDLSTTQSDIAVLQEKGFILEKVIGEGSYAKVYKATHMVDETRHSIMACKVIDTAKAPRDYLTKFLPRELDVLIRINHPHIVHVSNIFQRRAKYFIFLRFAENGDLLDFLTQNGAIPENQSRLWMRQIISGLQYIHTMNIAHRDLKCENVLVTANYNVKITDFGFARNVRQRDRDVLSETYCGSLSYAAPEVLKGVPYMPKLADMWSIGVILYTMLNKALPFNETSVKKLYEKQN

Summary

Similarity
Belongs to the protein kinase superfamily.
EMBL
BABH01000557    JTDY01000506    KOB76862.1    AGBW02004200    OWR55454.1    KQ459299    + More
KPJ01853.1    NWSH01003604    PCG66067.1    KQ460761    KPJ12523.1    ODYU01000577    SOQ35597.1    AAZO01005497    DS235786    EEB17054.1    KK107372    QOIP01000004    EZA51705.1    RLU23740.1    GL762841    EFZ20670.1    KQ764887    OAD54258.1    GL888932    EGI57207.1    KZ288439    PBC25730.1    JTDY01004102    KOB68598.1    KQ977059    KYN06039.1    GL434492    EFN74843.1    GBYB01015269    JAG85036.1    KQ980581    KYN15282.1    KQ982373    KYQ56993.1    KQ435826    KOX71989.1    ADTU01011290    LBMM01004298    KMQ92593.1    KQ976500    KYM83202.1    KQ971338    KYB28052.1    OWR55453.1    SOQ35598.1    KPJ12526.1    PCG66066.1    KPJ01854.1    KQ414670    KOC64434.1    KQ434857    KZC08871.1    LJIJ01000133    ODN01930.1    UFQT01000658    SSX26220.1    UFQS01000871    UFQT01000871    SSX07413.1    SSX27755.1    APGK01023097    KB740463    ENN80600.1    JTDY01007073    KOB65475.1    BABH01029921    KQ460045    KPJ18182.1    KQ459604    KPI92309.1    PYGN01002835    PSN29911.1    KQ434809    KZC06254.1    ODYU01009039    SOQ53153.1    NWSH01000091    PCG79688.1    KQ414667    KOC64664.1    AGBW02013634    OWR43061.1    GL450687    EFN80645.1    KZ288194    PBC33869.1    KQ435848    KOX71079.1    JN159476    AET21260.1    GEZM01046475    GEZM01046474    GEZM01046473    JAV77211.1    KQ971351    EFA06542.1    APGK01057807    KB741282    KB631802    ENN70804.1    ERL86256.1    GBHO01030567    JAG13037.1    KQ980734    KYN13801.1    KQ981305    KYN42937.1    ADTU01009973    GL888529    EGI59738.1    AAZO01003886    DS235339    EEB14914.1    PYGN01000730    PSN41587.1    KK107119    EZA58692.1    GECU01015517    JAS92189.1    GBYB01004932    JAG74699.1    KQ976455    KYM85117.1    GECZ01019434    JAS50335.1    GFTR01005875    JAW10551.1    GL766762    EFZ14632.1    GEBQ01002223    JAT37754.1    KQ982686    KYQ52330.1    UFQS01001902    UFQT01001902    SSX12670.1    SSX32113.1    CH964272    EDW84522.1    CH940652    EDW59340.1    CH902617    EDV42663.1    KOB76863.1    CP012526    ALC46309.1    ALC46310.1    CM000070    EAL27672.1    CH479179    EDW24830.1    OUUW01000013    SPP87984.1    CH954181    EDV48586.1    CH916369    EDV93282.1    CH933806    EDW14423.1    CM000160    EDW95920.1    KRK02799.1    JXJN01028586    CCAG010005923    AE014297    AY089432    AAF55571.1    AAL90170.1    CM000364    EDX12435.1    GAMC01012362    JAB94193.1    CH480820    EDW54632.1   
Pfam
PF00069   Pkinase        + More
PF10394   Hat1_N
PF13656   RNA_pol_L_2
Interpro
IPR000719   Prot_kinase_dom        + More
IPR011009   Kinase-like_dom_sf       
IPR017441   Protein_kinase_ATP_BS       
IPR008271   Ser/Thr_kinase_AS       
IPR016181   Acyl_CoA_acyltransferase       
IPR013523   Hist_AcTrfase_HAT1_C       
IPR037113   Hat1_N_sf       
IPR019467   Hat1_N       
IPR033898   RNAP_AC19       
IPR036603   RBP11-like       
IPR008193   RNA_pol_Rpb11_13-16kDa_CS       
IPR009025   RBP11-like_dimer       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
SUPFAM
SSF56112   SSF56112        + More
SSF55729   SSF55729       
SSF55257   SSF55257       
Gene 3D
PDB
2R0I     E-value=1.12794e-37,     Score=390

Ontologies

Topology

Length:
241
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.8714
Exp number, first 60 AAs:
0
Total prob of N-in:
0.02424
outside
1  -  241
 
 

Population Genetic Test Statistics

Pi
161.351739
Theta
126.047203
Tajima's D
1.009662
CLR
0.494463
CSRT
0.667016649167542
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号