SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07959
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.435
 

Sequence

CDS
ATGGACCGTGTTTGGGCGGACAGAAACATCTCGAGGAATACCAAAAAGCAGCTCGTCACCTCCCTTGTCTTTTCCATTTTTCTCTACGGCGCAGAGACTTGGACCCTCAAGAAAGCCGACCGCCAACGCATCGACGCGTTTGAGATGTGGTGCTGGAGGAAAATGCTCGGGATTCGTTGGACAGAACACAGAACCAACGAATCCATTCTTACCAAGCTCAAGATTCCAATGCGCCTCAGCACTACATGCGCGCGGAGGAGTTTCGAGATCTTTGGACATATCGCCAGAAAGAGAGGTGACAATCTGGAAAAGCTGCTGGTAACAGGCAAGGTATGCGGGAGAAGACATAGAGGCAGAAATCCAATGCGCTGGTCGGACCAAATACGCTCCACTCTCAATACCTCATTCCACGTTGCTATCCACACAGCCGAGGACAGGCAGGAATGGTGCAAGATGATGCAGGAGAAAGCTATTAGAGGAGGCCACGACCCTCAGCACTGA
Protein
MDRVWADRNISRNTKKQLVTSLVFSIFLYGAETWTLKKADRQRIDAFEMWCWRKMLGIRWTEHRTNESILTKLKIPMRLSTTCARRSFEIFGHIARKRGDNLEKLLVTGKVCGRRHRGRNPMRWSDQIRSTLNTSFHVAIHTAEDRQEWCKMMQEKAIRGGHDPQH

Summary

EMBL
ODYU01003523    SOQ42419.1    ODYU01001007    SOQ36619.1    ODYU01004401    SOQ44236.1    + More
FJ265548    ADI61816.1    FJ265557    ADI61825.1    FJ265546    ADI61814.1    RSAL01000289    RVE42931.1    FJ265553    ADI61821.1    FJ265547    ADI61815.1    FJ265552    ADI61820.1    FJ265560    ADI61828.1    GU815090    ADF18553.1    KZ150203    PZC72267.1    FJ265559    ADI61827.1    MRZV01000056    PIK60437.1    MRZV01000817    PIK43880.1    MRZV01002322    PIK33998.1    MRZV01001216    PIK39650.1    MRZV01000196    PIK55924.1    MRZV01001207    PIK39730.1    MRZV01000994    PIK41715.1    NCKU01012182    RWS00163.1    NCKU01008836    RWS01655.1    MRZV01000940    PIK42365.1    MRZV01000378    PIK51329.1    AHAT01022938    BART01031562    GAH15691.1    KL363256    KL367985    KFD50217.1    KFD59415.1    NCKU01004395    RWS06003.1    AAGJ04161766    AHAT01009145    AJ132772    CAA10770.1    AHAT01015286    AAGJ04055194    ABLF02042206    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    RQTK01000360    RUS81011.1    BDSA01000081    GBE63537.1    AHAT01017596    GBBM01006298    JAC29120.1    KL363266    KL367526    KFD49675.1    KFD66333.1    AAGJ04075245    KZ149985    PZC75696.1    ABLF02012409    ABLF02012412    KK852482    KDR22935.1    GGMS01004979    MBY74182.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002138   Pept_C14_p10       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
166
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
8.83407999999999
Exp number, first 60 AAs:
8.8339
Total prob of N-in:
0.66132
outside
1  -  166
 
 

Population Genetic Test Statistics

Pi
354.509312
Theta
154.182042
Tajima's D
3.994298
CLR
0
CSRT
0.999200039998
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号