Gene

KWMTBOMO07940

Pre Gene Modal

BGIBMGA001163

Annotation

PREDICTED:_cAMP-dependent_protein_kinase_catalytic_subunit_alpha-like_[Papilio_xuthus]

Location

Bomo_Chr13(-):10541699-10543086      View in EpiBrowser

Full name

cAMP-dependent protein kinase catalytic subunit       + More
cAMP-dependent protein kinase catalytic subunit alpha      

Location in the cell

Cytoplasmic   Reliability : 3.429

CDS

ATGGCAGATAGTGAAATTAAAAGGCATATAAATTCACCACGTGGTGATTTGATACAACACGGTGGCTATTCTCCTGCAAAACAAGAACAATACTCTCAATATTTAAAGAAACTCCGTCAAGATTTTGTTGAGTCATGGGATGATAAATCTGAAAGTAATGCAAAGTTGAATGATTTTGAAAGACAAAAAGTTTTAGGAACAGGAGCATTTGGCATTGTTTTTCTTGTAAAGCATATTGTAACAGGTAAATATTATGCTATGAAAATGCTCGAAAAAGAGAAAATTGTTAGATTGAAACAAATTGAGCACAGCTACTACGAAAAAAAGATTCTATGTGGCTTAAATTTTCCTTTTGTTGTTTACATGAAATACTATTTTAAGGATAACGTTTATCTTTATTACGTTCTACCTTTCATAGCCGGTGGGGAAATGTTTTCACATTTACGTAAAATGGGCAAGTTTGAAGAAACTTCTGCAAAATTTTACGGAGCACAAGTTATACTAGCATTGGAATATCTGCACGCTTGTGAATTAGTATATCGAGATCTAAAGCCCGAGAATATATTAATAGATCGTACAGGTTATATCAAAATTACTGACTTCGGTTTCTGTAAGCTTATCCGCGGTAGGACTTGGACACTTTGCGGTACTCCAGAATATTTAGCACCTGAAATCATTCTAAGCAAAGGCTATGGAATGTCAGTCGACTGGTGGTCCCTAGGGGTATTACTTTTCGAAATGAGTGCCGGGCATCCACCATTTTTTGCTTCGGATCCAATGAGAATTTATGAAAAAATTGTGGCAGGAAAATATAGATGTCCATCACATTTTTCTGTTGAATTAAAAGATATAATAGGACATGTTTTACAAGTCGACACAACAAGACGTTACGGAACTCTTAAAGATGGCGTGTTGGATTTTAAAAATCATAAATGGTTTAGAGAAATCGATTGGGATAGTATTTTGAATAGTCGCATACATCCGCCGTTTTTTCCAAAGATACGTTCACCAGGCGACACCACTAATTTCGATGTTTTTGATGAAGAAAAAATTAAAGACAGTCCAGTATGTCTTTATGAAGAAGAATTTGCTGATTTTTAA

Protein

MADSEIKRHINSPRGDLIQHGGYSPAKQEQYSQYLKKLRQDFVESWDDKSESNAKLNDFERQKVLGTGAFGIVFLVKHIVTGKYYAMKMLEKEKIVRLKQIEHSYYEKKILCGLNFPFVVYMKYYFKDNVYLYYVLPFIAGGEMFSHLRKMGKFEETSAKFYGAQVILALEYLHACELVYRDLKPENILIDRTGYIKITDFGFCKLIRGRTWTLCGTPEYLAPEIILSKGYGMSVDWWSLGVLLFEMSAGHPPFFASDPMRIYEKIVAGKYRCPSHFSVELKDIIGHVLQVDTTRRYGTLKDGVLDFKNHKWFREIDWDSILNSRIHPPFFPKIRSPGDTTNFDVFDEEKIKDSPVCLYEEEFADF

Description

Essential for larval development (PubMed:22887816). Controls the rhythmic contraction of enteric muscles probably by regulating G-protein coupled receptor aex-2-mediated calcium influx in GABAergic DVB neurons (PubMed:24086161). Plays a role in the control of oocyte meiotic maturation by gonadal sheath cells (PubMed:22887816).
Isoforms a and b: May play a role in the regulation of neuromuscular junctions.
Phosphorylates a large number of substrates in the cytoplasm and the nucleus. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates CDC25B, ABL1, NFKB1, CLDN3, PSMC5/RPT6, PJA2, RYR2, RORA and VASP. RORA is activated by phosphorylation. Required for glucose-mediated adipogenic differentiation increase and osteogenic differentiation inhibition from osteoblasts. Involved in the regulation of platelets in response to thrombin and collagen; maintains circulating platelets in a resting state by phosphorylating proteins in numerous platelet inhibitory pathways when in complex with NF-kappa-B (NFKB1 and NFKB2) and I-kappa-B-alpha (NFKBIA), but thrombin and collagen disrupt these complexes and free active PRKACA stimulates platelets and leads to platelet aggregation by phosphorylating VASP. Prevents the antiproliferative and anti-invasive effects of alpha-difluoromethylornithine in breast cancer cells when activated. RYR2 channel activity is potentiated by phosphorylation in presence of luminal Ca(2+), leading to reduced amplitude and increased frequency of store overload-induced Ca(2+) release (SOICR) characterized by an increased rate of Ca(2+) release and propagation velocity of spontaneous Ca(2+) waves, despite reduced wave amplitude and resting cytosolic Ca(2+). PSMC5/RPT6 activation by phosphorylation stimulates proteasome. Negatively regulates tight junctions (TJs) in ovarian cancer cells via CLDN3 phosphorylation. NFKB1 phosphorylation promotes NF-kappa-B p50-p50 DNA binding. Involved in embryonic development by down-regulating the Hedgehog (Hh) signaling pathway that determines embryo pattern formation and morphogenesis. Prevents meiosis resumption in prophase-arrested oocytes via CDC25B inactivation by phosphorylation. May also regulate rapid eye movement (REM) sleep in the pedunculopontine tegmental (PPT) (By similarity). Phosphorylates APOBEC3G and AICDA (By similarity). Phosphorylates HSF1; this phosphorylation promotes HSF1 nuclear localization and transcriptional activity upon heat shock (By similarity).

Catalytic Activity

ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]
ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]

Subunit

Heterotetramer composed of two regulatory subunits and two catalytic subunits.
A number of inactive tetrameric holoenzymes are produced by the combination of homo- or heterodimers of the different regulatory subunits associated with two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Activates cAMP-sensitive PKAI and PKAII holoenzymes by interacting with regulatory subunit (R) of PKA, PRKAR1A/PKR1 and PRKAR2A/PKR2, respectively. Interacts with NFKB1, NFKB2 and NFKBIA in platelets; these interactions are disrupted by thrombin and collagen. Binds to ABL1 in spermatozoa and with CDC25B in oocytes (By similarity). Interacts with APOBEC3G and AICDA (By similarity). Interacts with RAB13; downstream effector of RAB13 involved in tight junction assembly. Found in a complex at least composed of MROH2B, PRKACA and TCP11 (By similarity). Interacts with MROH2B (By similarity). Interacts with TCP11 (By similarity). Interacts with HSF1 (By similarity).

Similarity

Belongs to the protein kinase superfamily.
Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.

Keywords

Alternative splicing   ATP-binding   cAMP   Complete proteome   Kinase   Lipoprotein   Myristate   Nucleotide-binding   Phosphoprotein   Reference proteome   Transferase   3D-structure   Cell membrane   Cell projection   Cilium   Cytoplasm   Cytoplasmic vesicle   Direct protein sequencing   Flagellum   Membrane   Mitochondrion   Nucleus  

Feature

chain  cAMP-dependent protein kinase catalytic subunit
splice variant  In isoform c.

Uniprot

H9IV83   A0A194Q915   A0A0N1IPW6   A0A0L7LC89   A0A212ER70   A0A212EWD5   + More
A0A0L7LQB0   A0A194R2E1   A0A194PZ30   E0VEQ2   A0A0C9RV13   A0A0L7R855   A0A1D5P0J5   A0A218VET5   A0A2A2J6C5   A0A1Y1N4Z4   U3JU00   A0A1D5NW04   A0A094KSF4   A0A2I0MEC8   A0A091TYR0   A0A091T8G2   A0A1D5PLV3   A0A0Q3LUM3   A0A091HTZ5   A0A151NJ57   A0A1U7SDV1   A0A091VJW1   H3AXE1   V9KQ53   A0A0B8RRH8   A0A1W7RIS1   J3SBX2   T1E718   U3F901   A0A094L3Q4   A0A151NJ10   A0A3Q0HA31   G1N3V9   A0A087V9U4   A0A091NAU9   A0A1U7SGF3   A0A2A2J6B5   A0A093CTL8   A0A1V4JYX0   A0A091H3Y8   A0A3L8SQJ8   A0A151NJ28   A0A091JZS9   A0A091GF94   P21137-12   A0A091EJ36   A0A093NJS6   A0A087QHL7   A0A091WFF0   A0A091MDI6   A0A091LYA7   A0A0A0AFY6   A0A226PKL4   P21137-6   A0A2I0MED5   K7FHV7   A0A3Q0H5E5   R0JPM8   P21137-8   A0A3Q0HA50   H0Z8E2   A0A1U7S2J4   P21137-13   R4GIN8   A0A2A2J6Y2   A0A3Q0H6Q6   A0A2A2J6X7   A0A091RLQ8   A0A091QAC2   A0A093HF97   P21137-2   A0A093GDJ5   A0A093Q3X5   A0A091IX21   A0A098M014   A0A091PTQ1   H9GAL8   R4GCW7   A0A1I7VJD7   A0A3L8DY06   P21137-7   V9KWZ2   F6UP78   A0A0K0JSZ6   A0A170RC44   K7FHX4   A0A2K6D6Z3   A0A2K6MG58   A0A2K5VKF2   A0A2K5ZY03   A0A2K6NMP1   A0A2K5NNF3   H9FWY1   P00517  

EC Number

2.7.11.11

Pubmed

19121390    26354079    26227816    22118469    20566863    15592404    + More
28004739    23371554    22293439    9215903    24402279    25476704    26358130    23025625    23758969    25727380    23915248    20838655    30282656    2324104    9851916    10085246    9299544    16806821    18077108    22286028    22887816    24086161    24621616    17381049    20360741    21881562    25217238    30249741    20431018    17885136    25362486    25319552    1420367    6262777    6311252    6286662    9521123    10684253    11152138    15096524    8824261    9438863   

EMBL

BABH01000681    KQ459299    KPJ01909.1    KQ460202    KPJ17176.1    JTDY01001711    + More
KOB73103.1    AGBW02013095    OWR43992.1    AGBW02012010    OWR45805.1    JTDY01000340    KOB77630.1    KQ460855    KPJ11867.1    KQ459584    KPI98576.1    AAZO01001585    DS235093    EEB11858.1    GBYB01011506    JAG81273.1    KQ414637    KOC66936.1    AADN05000647    MUZQ01000002    OWK64503.1    LIAE01010642    PAV57368.1    GEZM01015981    JAV91396.1    AGTO01021089    KL262375    KFZ60277.1    AKCR02000018    PKK28038.1    KK408331    KFQ83376.1    KK945962    KFQ54356.1    LMAW01003072    KQK74224.1    KL217788    KFO98612.1    AKHW03002907    KYO36790.1    KK734081    KFR03712.1    AFYH01051841    AFYH01051842    AFYH01051843    AFYH01051844    AFYH01051845    AFYH01051846    AFYH01051847    AFYH01051848    AFYH01051849    AFYH01051850    JW867900    AFP00418.1    GBSH01000536    JAG68489.1    GDAY02000383    JAV51030.1    JU174069    GBEX01000552    AFJ49595.1    JAI14008.1    GAAZ01000411    GBKC01000571    JAA97532.1    JAG45499.1    GAEP01000269    GBEW01000184    JAB54552.1    JAI10181.1    KL350738    KFZ58739.1    KYO36791.1    KL485232    KFO09386.1    KL380329    KFP86838.1    PAV57358.1    KL248304    KFV16254.1    LSYS01005497    OPJ77408.1    KL520265    KFO89395.1    QUSF01000010    RLW06015.1    KYO36792.1    KK540411    KFP30707.1    KL447384    KFO72782.1    M37119    M37114    M37115    M37116    M37117    M37118    Z82096    Z81511    AJ011936    AJ011937    AJ011938    AJ012354    AJ012355    AJ012356    KK718445    KFO56612.1    KL224623    KFW62215.1    KL225597    KFM00721.1    KL410872    KFR00341.1    KK527473    KFP68664.1    KL300969    KFP51276.1    KL871737    KGL93061.1    AWGT02000057    OXB80050.1    PKK28039.1    AGCU01066600    AGCU01066601    AGCU01066602    AGCU01066603    AGCU01066604    AGCU01066605    AGCU01066606    AGCU01066607    AGCU01066608    AGCU01066609    KB743342    EOA99300.1    ABQF01041419    ABQF01041420    ABQF01041421    ABQF01041422    ABQF01041423    PAV57363.1    PAV57369.1    KK802033    KFQ29452.1    KK692017    KFQ22039.1    KL206233    KFV80346.1    KL215901    KFV67258.1    KL670376    KFW78932.1    KK501110    KFP12867.1    GBSI01000439    JAC96057.1    KK678206    KFQ10696.1    AAWZ02004438    QOIP01000003    RLU25256.1    JW871135    AFP03653.1    AAMC01003225    AAMC01003226    AAMC01003227    AAMC01003228    AAMC01003229    AAMC01003230    KU193794    ANB82449.1    AQIA01003548    AQIA01003549    AQIA01003550    AQIA01003551    JU335387    JV043888    AFE79140.1    AFI33959.1    X67154   

Proteomes

UP000005204    UP000053268    UP000053240    UP000037510    UP000007151    UP000009046    + More
UP000053825    UP000000539    UP000197619    UP000218231    UP000016665    UP000053872    UP000051836    UP000054308    UP000050525    UP000189705    UP000053605    UP000008672    UP000001645    UP000190648    UP000276834    UP000053760    UP000001940    UP000052976    UP000054081    UP000053286    UP000053283    UP000053858    UP000198419    UP000007267    UP000007754    UP000053584    UP000053875    UP000053258    UP000053119    UP000001646    UP000095285    UP000279307    UP000008143    UP000006672    UP000233120    UP000233180    UP000233100    UP000233140    UP000233200    UP000233060    UP000009136   

PRIDE

H9IV83    P21137    R4GIN8    P00517   

Pfam

PF00069   Pkinase

Interpro

IPR000719   Prot_kinase_dom        + More
IPR000961   AGC-kinase_C       
IPR017441   Protein_kinase_ATP_BS       
IPR011009   Kinase-like_dom_sf       
IPR008271   Ser/Thr_kinase_AS       
IPR039083   PKA_C-beta       
IPR039035   PKA_C-alpha       

SUPFAM

SSF56112   SSF56112       

ProteinModelPortal

H9IV83   A0A194Q915   A0A0N1IPW6   A0A0L7LC89   A0A212ER70   A0A212EWD5   + More
A0A0L7LQB0   A0A194R2E1   A0A194PZ30   E0VEQ2   A0A0C9RV13   A0A0L7R855   A0A1D5P0J5   A0A218VET5   A0A2A2J6C5   A0A1Y1N4Z4   U3JU00   A0A1D5NW04   A0A094KSF4   A0A2I0MEC8   A0A091TYR0   A0A091T8G2   A0A1D5PLV3   A0A0Q3LUM3   A0A091HTZ5   A0A151NJ57   A0A1U7SDV1   A0A091VJW1   H3AXE1   V9KQ53   A0A0B8RRH8   A0A1W7RIS1   J3SBX2   T1E718   U3F901   A0A094L3Q4   A0A151NJ10   A0A3Q0HA31   G1N3V9   A0A087V9U4   A0A091NAU9   A0A1U7SGF3   A0A2A2J6B5   A0A093CTL8   A0A1V4JYX0   A0A091H3Y8   A0A3L8SQJ8   A0A151NJ28   A0A091JZS9   A0A091GF94   P21137-12   A0A091EJ36   A0A093NJS6   A0A087QHL7   A0A091WFF0   A0A091MDI6   A0A091LYA7   A0A0A0AFY6   A0A226PKL4   P21137-6   A0A2I0MED5   K7FHV7   A0A3Q0H5E5   R0JPM8   P21137-8   A0A3Q0HA50   H0Z8E2   A0A1U7S2J4   P21137-13   R4GIN8   A0A2A2J6Y2   A0A3Q0H6Q6   A0A2A2J6X7   A0A091RLQ8   A0A091QAC2   A0A093HF97   P21137-2   A0A093GDJ5   A0A093Q3X5   A0A091IX21   A0A098M014   A0A091PTQ1   H9GAL8   R4GCW7   A0A1I7VJD7   A0A3L8DY06   P21137-7   V9KWZ2   F6UP78   A0A0K0JSZ6   A0A170RC44   K7FHX4   A0A2K6D6Z3   A0A2K6MG58   A0A2K5VKF2   A0A2K5ZY03   A0A2K6NMP1   A0A2K5NNF3   H9FWY1   P00517  

PDB

1YDT     E-value=1.19194e-124,     Score=1142

KEGG

101736532    K04345 protein kinase A [EC:2.7.11.11] | (RefSeq) cAMP-dependent protein kinase catalytic subunit al

PATHWAY

04140    Autophagy - animal - Bombyx mori (domestic silkworm)
04213    Longevity regulating pathway - multiple species - Bombyx mori (domestic silkworm)
04310    Wnt signaling pathway - Bombyx mori (domestic silkworm)
04341    Hedgehog signaling pathway - fly - Bombyx mori (domestic silkworm)

GO

GO:0034237   GO:0004691   GO:0007186   GO:0005524   GO:0004674   GO:0016021   GO:1900195   GO:0006468   GO:0005952   GO:0001669   GO:0036126   GO:0004672   GO:0005634   GO:0010737   GO:0005886   GO:0005739   GO:0019904   GO:0005737   GO:0001707   GO:0071333   GO:0048471   GO:0031594   GO:0034605   GO:0018105   GO:0043015   GO:0007169   GO:0016020   GO:0006412   GO:0016876   GO:0043039  

PANTHER

PTHR24353:SF116   PTHR24353:SF82  

Subcellular location

Cytoplasm   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Nucleus   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Cell membrane   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Mitochondrion   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Membrane   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Cell projection   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Cilium   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Flagellum   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Cytoplasmic vesicle   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Secretory vesicle   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.
Acrosome   Translocates into the nucleus (monomeric catalytic subunit). The inactive holoenzyme is found in the cytoplasm. Distributed throughout the cytoplasm in meiotically incompetent oocytes. Associated to mitochondrion as meiotic competence is acquired. Aggregates around the germinal vesicles (GV) at the immature GV stage oocytes (By similarity). Colocalizes with MROH2B and TCP11 on the acrosome and tail regions in round spermatids and spermatozoa regardless of the capacitation status of the sperm (By similarity). Colocalizes with HSF1 in nuclear stress bodies (nSBs) upon heat shock (By similarity).   With evidence from 9 publications.

Length:

366

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

32.8859600000001

Exp number, first 60 AAs:

0.00337

Total prob of N-in:

0.39446

outside

1  -  366

 

 

Pi

209.269885

Theta

217.335283

Tajima's D

-0.15855

CLR

0.206851

CSRT

0.327033648317584

Interpretation

Uncertain