SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07839
Annotation
Fam-a_protein_[Operophtera_brumata]
Location in the cell
Nuclear   Reliability : 1.914
 

Sequence

CDS
ATGAATAAAGTTCTTGTGATCTGCTTTATACTCACTGCAGTGGTCGTCGTAATAGAAAGCAGCCCATTCTTAAAACAAATAAAATCCCAAGGCGATTCTGATCTGGTACTAGATAAGAATGTTTGTGAACCCAGATTCAAGACAAATGCAGGGCAGAGTAAAGGAATTTTATCGCAGAACAATATTGCTCAAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGTGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGATACTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGTGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGATACTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATGGCGGCTCAGATGGTGGTTCTAAAAGCTCACAACATGATGACTCTAATCATGGCGGCTCAGATTGTGGTTCTGAAAAGAAAGCGAAAAAACATAAAAGCAAGCCGTGTAACTAAAGAAAATTTAGCAACACCATGTACTGTTCCTTATTTTAAACTTAATATAAATGTACTATCAATAATTCAACAAATAACTAGATTTGGATAG
Protein
MNKVLVICFILTAVVVVIESSPFLKQIKSQGDSDLVLDKNVCEPRFKTNAGQSKGILSQNNIAQKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMVAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVILKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMVAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVILKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLMMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLIMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQMAAQMVVLKAHNMMTLIMAAQIVVLKRKRKNIKASRVTKENLATPCTVPYFKLNINVLSIIQQITRFG

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

SignalP
Position:   1 - 20,         Likelihood:  0.973746
 
 
Length:
1087
Number of predicted TMHs:
25
Exp number of AAs in TMHs:
546.73863
Exp number, first 60 AAs:
19.04998
Total prob of N-in:
0.76374
POSSIBLE N-term signal
sequence
outside
1  -  4
TMhelix
5  -  24
inside
25  -  78
TMhelix
79  -  101
outside
102  -  120
TMhelix
121  -  140
inside
141  -  159
TMhelix
160  -  182
outside
183  -  196
TMhelix
197  -  219
inside
220  -  251
TMhelix
252  -  274
outside
275  -  288
TMhelix
289  -  311
inside
312  -  322
TMhelix
323  -  342
outside
343  -  361
TMhelix
362  -  381
inside
382  -  412
TMhelix
413  -  435
outside
436  -  454
TMhelix
455  -  474
inside
475  -  493
TMhelix
494  -  516
outside
517  -  530
TMhelix
531  -  553
inside
554  -  572
TMhelix
573  -  592
outside
593  -  606
TMhelix
607  -  629
inside
630  -  649
TMhelix
650  -  667
outside
668  -  686
TMhelix
687  -  706
inside
707  -  737
TMhelix
738  -  760
outside
761  -  779
TMhelix
780  -  799
inside
800  -  818
TMhelix
819  -  841
outside
842  -  855
TMhelix
856  -  878
inside
879  -  897
TMhelix
898  -  917
outside
918  -  940
TMhelix
941  -  963
inside
964  -  983
TMhelix
984  -  1006
outside
1007  -  1020
TMhelix
1021  -  1043
inside
1044  -  1087
 
 

Population Genetic Test Statistics

Pi
410.810066
Theta
187.852798
Tajima's D
0.624572
CLR
188.881246
CSRT
0.549472526373681
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号