SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07743
Annotation
PREDICTED:_piggyBac_transposable_element-derived_protein_4-like_[Amyelois_transitella]
Location in the cell
Mitochondrial   Reliability : 1.942 Nuclear   Reliability : 1.558
 

Sequence

CDS
ATGGGTTACATAGTTACAGTCAAATACATAGCTGAGGTCACCGGTGCACCCCATGGCGCACAAATACAGAAAATATATTTTCCGGTACCCGGCGCCGCGCCGGCCACCCCGCCGGCCACCCGCTACACCAGTAGTGCGCTCGCGCCAACAAATGTGGTGATGGCACTATGTGAAAATATATTTGACAAAGGACACACGCTAGCAACTGATAATTGGTACACTAGCTTGCAACTGGCTTATCGGTTATTGGAGAAGCAAACCCATTTAATTGGCACATTGCGAAAAAACAGAAGAGGATTGCCTAAGGCTGTTGTTGATTCGAAACTGCAAAAAGGTGAAACAATGGCTATGGAGAATGAAGATGGAGTAACAGTGCTTAAATGGAAAGATAAGAGGGACGTGCTTATGCTGTCGACAAAGCATTCCGACAAAATTGCTGTGGTGGTGAAAAAAGGCAAACAGATTCGTAAACCAAAAGCTATTTTGGATTATAATAAATCGAAAGGGTCTGTAGACATGAGTGACCAGATGGGTGCCTATTCTTCGCCATTGCGGAAAACCGTAAAATGGTATAGAAAATTGGCAATAGAACTACTTCTAAATACGGCAGTTGTAAATGCTTGGGTCATGTACAATGAAAATAAGCAGAGCAAATCTTCAATTGTCGACTTTAGGAGGGCTCTCATAAATTATTTGACTCGGCCAGCAGATTCCCAAGAAATAATTATCAATGAAAGACCTAAAAGACTCAAGCATGTTCTAAAATTAAAGGAAGGAAAAGTAAGAGACACGCGTCGTTTTTGCGTGAAATGTTATAAAGATTCAGTACAGGAATTTGGTCGTAAAGTAGCTAAGAATAAAGCTAAGAAATAA
Protein
MGYIVTVKYIAEVTGAPHGAQIQKIYFPVPGAAPATPPATRYTSSALAPTNVVMALCENIFDKGHTLATDNWYTSLQLAYRLLEKQTHLIGTLRKNRRGLPKAVVDSKLQKGETMAMENEDGVTVLKWKDKRDVLMLSTKHSDKIAVVVKKGKQIRKPKAILDYNKSKGSVDMSDQMGAYSSPLRKTVKWYRKLAIELLLNTAVVNAWVMYNENKQSKSSIVDFRRALINYLTRPADSQEIIINERPKRLKHVLKLKEGKVRDTRRFCVKCYKDSVQEFGRKVAKNKAKK

Summary

Similarity
Belongs to the universal ribosomal protein uS3 family.
EMBL
GAIX01005691    JAA86869.1    GBBI01004438    JAC14274.1    GBBI01004440    JAC14272.1    + More
GAIX01013935    JAA78625.1    ATLV01021248    KE525315    KFB46173.1    GAIX01004551    JAA88009.1    ABLF02015113    GECU01032257    GECU01013302    JAS75449.1    JAS94404.1    ABLF02025866    ABLF02025869    ABLF02025877    ABLF02038619    ABLF02011361    ABLF02018838    GFXV01007414    MBW19219.1    KE125214    EPB70205.1    KE125300    EPB69401.1    JARK01001552    EYB90668.1    ABLF02011601    ABLF02011602    GDRN01069744    JAI63996.1    JARK01001346    EYC26204.1    ABLF02030622    ABLF02030627    GEBQ01028741    JAT11236.1    ABLF02010187    ABLF02050407    GGMS01006604    MBY75807.1    ABLF02011864    ABLF02011866    ABLF02042566    UYSL01019948    VDL71548.1    GBBI01004439    JAC14273.1    GECU01034165    JAS73541.1    ABLF02002863    ABLF02002864    GECU01016947    JAS90759.1    JARK01001390    EYC10641.1    GGMS01004555    MBY73758.1    ABLF02029982    JARK01001356    EYC20951.1    ABLF02007064    ACPB03026393    UYSL01020365    VDL74272.1    EYC26339.1    EYC26340.1    UZAF01016313    VDO25445.1    GAIX01003729    JAA88831.1    GEBQ01001683    JAT38294.1    CAVP010060744    CDL96544.1    ABLF02012265    KE647206    EQB60920.1    ODYU01012748    SOQ59213.1    KE647018    EQB62075.1    UZAH01030316    VDP10112.1    JOJR01000056    RCN47811.1    ABLF02029983    GALX01005527    JAB62939.1    AAAB01008986    EAA43299.1    UXUI01007140    VDD85673.1    ABLF02016107    JARK01001477    EYB97365.1    ABLF02010611    ABLF02010612    ABLF02017387    GFXV01004053    MBW15858.1    GGMS01012057    MBY81260.1    ABLF02028028    UZAF01018515    VDO52364.1    UZAH01001106    VDO19503.1    ABLF02013737    ABLF02006169    ABLF02055685    GEDC01003168    JAS34130.1   
Pfam
PF13843   DDE_Tnp_1_7        + More
PF05699   Dimer_Tnp_hAT
PF02037   SAP
PF00188   CAP
PF00189   Ribosomal_S3_C
PF07650   KH_2
PF13842   Tnp_zf-ribbon_2
PF05380   Peptidase_A17
Interpro
IPR029526   PGBD        + More
IPR008906   HATC_C_dom       
IPR012337   RNaseH-like_sf       
IPR003034   SAP_dom       
IPR036361   SAP_dom_sf       
IPR014044   CAP_domain       
IPR035940   CAP_sf       
IPR005703   Ribosomal_S3_euk/arc       
IPR036419   Ribosomal_S3_C_sf       
IPR001351   Ribosomal_S3_C       
IPR004044   KH_dom_type_2       
IPR018280   Ribosomal_S3_CS       
IPR015946   KH_dom-like_a/b       
IPR009019   KH_sf_prok-type       
IPR032718   PGBD4_C_Znf-ribbon       
IPR008042   Retrotrans_Pao       
SUPFAM
SSF53098   SSF53098        + More
SSF68906   SSF68906       
SSF55797   SSF55797       
SSF54821   SSF54821       
SSF54814   SSF54814       

Ontologies

Topology

Length:
290
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.92622
Exp number, first 60 AAs:
0.00583
Total prob of N-in:
0.15839
outside
1  -  290
 
 

Population Genetic Test Statistics

Pi
251.443605
Theta
176.691951
Tajima's D
1.330967
CLR
0
CSRT
0.752012399380031
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号