Gene

KWMTBOMO07720

Pre Gene Modal

BGIBMGA000879

Annotation

PREDICTED:_retinal_rod_rhodopsin-sensitive_cGMP_3'?5'-cyclic_phosphodiesterase_subunit_delta_[Papilio_machaon]

Location

Bomo_Chr13(+):5210436-5214254      View in EpiBrowser

Full name

Probable cGMP 3',5'-cyclic phosphodiesterase subunit delta       + More
Phosphodiesterase delta-like protein      
Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta      

Alternative Name

Protein p17

Location in the cell

Nuclear   Reliability : 2.199

CDS

ATGACTGACGTTCTAACAACTGAACGAGATAAAAATGATCGTGTGGAGACTATTCTGAAGGGATTTCAAATTAATTGGATGAATCTTCGTGATGCTGACACAGGAAAAATTCTTTGGCAACATAATGAGGACATGTCAAGTCCAGATGCGGAACACGAAGCAAGAGTACCCAAAAGAATTCTCAAGTGCAGAGTAGTGTCTCGTGAAATGAACTTCAGCTCAATAGAATCCATGGATAGATTTAGATTAGAACAGAAAGTACTCTTCAAAGGGAGATGTTTAGAAGAGTGGTTTTTCGATTTTGGTTATGTGATCCCGAACTCAACGAACACTTGGCAATCCGTTATAGAGTCAGCGCCTGAATCGCAAATGATGCCGGCCAATGTGCTCAATGGGAACGTGGTTATCGAAACGAAATTTTTTGATGGAGATTTGCTGATCACAACCTCTAGAGTACGACTGTTCTATATATGA

Protein

MTDVLTTERDKNDRVETILKGFQINWMNLRDADTGKILWQHNEDMSSPDAEHEARVPKRILKCRVVSREMNFSSIESMDRFRLEQKVLFKGRCLEEWFFDFGYVIPNSTNTWQSVIESAPESQMMPANVLNGNVVIETKFFDGDLLITTSRVRLFYI

Description

Promotes the release of prenylated target proteins from cellular membranes. Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location. Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E. Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate.
Promotes the release of prenylated target proteins from cellular membranes (By similarity). Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location (By similarity). Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E (By similarity). Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (By similarity). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate (By similarity).
Promotes the release of prenylated target proteins from cellular membranes (PubMed:8798640). Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location (By similarity). Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E (By similarity). Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (By similarity). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate (By similarity).
Promotes the release of prenylated target proteins from cellular membranes (PubMed:9712853). Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location (PubMed:22002721, PubMed:23698361). Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E (PubMed:24166846). Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (By similarity). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate (By similarity).

Subunit

Interacts with the prenylated catalytic subunits of PDE6, an oligomer composed of two catalytic chains and two inhibitory chains; has no effect on enzyme activity but promotes the release of the prenylated enzyme from cell membrane.
Interacts with the prenylated catalytic subunits of PDE6, an oligomer composed of two catalytic chains (PDE6A and PDE6B) and two inhibitory chains (gamma); has no effect on enzyme activity but promotes the release of the prenylated enzyme from cell membrane (By similarity). Interacts with prenylated GRK1 and GRK7 (By similarity). Interacts with prenylated INPP5E (By similarity). Interacts with prenylated Ras family members, including HRAS, KRAS, NRAS, RAP2A, RAP2C and RHEB (By similarity). Interacts with RAB13 (prenylated form); dissociates RAB13 from membranes (By similarity). Interacts with RPGR (By similarity). Interacts with ARL2 (By similarity). Interacts with ARL3; the interaction occurs specifically with the GTP-bound form of ARL3 (By similarity). Interaction with ARL2 and ARL3 promotes release of farnesylated cargo proteins (By similarity).
Interacts with the prenylated catalytic subunits of PDE6, an oligomer composed of two catalytic chains (PDE6A and PDE6B) and two inhibitory chains (gamma); has no effect on enzyme activity but promotes the release of the prenylated enzyme from cell membrane (PubMed:8798640). Interacts with prenylated GRK1 and GRK7 (PubMed:14561760). Interacts with prenylated INPP5E (By similarity). Interacts with prenylated Ras family members, including HRAS, KRAS, NRAS, RAP2A, RAP2C and RHEB (By similarity). Interacts with RAB13 (prenylated form); dissociates RAB13 from membranes (By similarity). Interacts with RPGR (By similarity). Interacts with ARL2 (PubMed:14561760). Interacts with ARL3; the interaction occurs specifically with the GTP-bound form of ARL3 (By similarity). Interaction with ARL2 and ARL3 promotes release of farnesylated cargo proteins (By similarity).
Interacts with the prenylated catalytic subunits of PDE6, an oligomer composed of two catalytic chains (PDE6A and PDE6B) and two inhibitory chains (gamma); has no effect on enzyme activity but promotes the release of the prenylated enzyme from cell membrane (By similarity). Interacts with prenylated GRK1 and GRK7 (By similarity). Interacts with prenylated Ras family members, including RAP2A and RAP2C (By similarity). Interacts with prenylated RHEB and NRAS (PubMed:22002721). Interacts with prenylated HRAS and KRAS. Interacts with RAB13 (prenylated form); dissociates RAB13 from membranes (PubMed:9712853). Interacts with prenylated INPP5E (PubMed:24166846). Interacts with RPGR (PubMed:9990021, PubMed:24166846, PubMed:23559067). Interacts with ARL2 (PubMed:24166846, PubMed:22002721). Interacts with ARL3; the interaction occurs specifically with the GTP-bound form of ARL3 (PubMed:24166846). Interaction with ARL2 and ARL3 promotes release of farnesylated cargo proteins (PubMed:22002721).

Similarity

Belongs to the PDE6D/unc-119 family.

Keywords

Cell projection   cGMP   Complete proteome   Cytoplasm   Cytoplasmic vesicle   Cytoskeleton   Membrane   Reference proteome   Sensory transduction   Vision   Direct protein sequencing   3D-structure   Ciliopathy   Joubert syndrome  

Feature

chain  Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

Uniprot

A0A2A4JCP5   A0A2W1BL10   A0A2H1VGT6   S4P836   H9IUE9   A0A194RSP0   + More
A0A222AJF3   A0A0N0BJV9   A0A3L8DRK9   A0A194PD65   F4X519   A0A154P3N7   E2ALH0   E2C3E8   A0A088AMF8   R4WDD2   A0A0F7VHB0   A0A1B6E4X0   E9ICR9   A0A087U942   A0A0A9Z326   A0A0V0GDB8   T1HZU2   A0A0K8R3M0   E0VSJ1   A0A224Z7U2   A0A131YJV4   A0A131XN42   A0A2B4SA18   A0A131Y355   A0A224XYW4   H3AW39   E2J7D6   A0A293MXS2   A0A1Z5L0H9   A7SFK7   A0A1U7RQZ7   K4FYN5   A0A0P7UZU8   U3F978   G9KFR8   A0A1W5ALY7   M3Y0G7   Q9XT54   H0ZHQ2   W5LZK1   A0A3Q2XNJ1   F1SMV2   Q6DH83   A0A3B3D8M1   F1QZ52   I3M7F1   K9IYB0   A0A3Q7QTA1   A0A2Y9H2Z7   A0A2U3XS88   A0A2I2V1R8   A0A2Y9IWV0   A0A2U3VM51   A0A3Q7UGI7   Q95142   G3RCF1   A0A2R9ACJ4   A0A2K5C118   A0A2K6NXU1   A0A2K5R3A5   A0A2K6TJP9   H2P8W8   H2QJL5   Q6IB24   O43924   A0A341B407   A0A2U3UYK7   A0A340XTZ8   A0A2Y9FJH4   A0A2Y9MN01   A0A384ABW9   A0A212EY25   A0A0P6J443   A0A023GBU3   A0A2Y9E9N8   A0A1B6KXW7   A0A1U7QZ77   A0A1B6G5Q2   A0A218UWD8   A0A3M0JMF3   A0A1V4KP47   U3JYV3   A0A2K6BU11   G7PKA4   A0A2K5YLR0   F7BMR1   W5U688   C3ZYY6   A0A3Q2CXT1   A0A1U7UZ61   H9GII4   V4BQV6   A0A3B3HQE9   A0A3P9ITK7  

Pubmed

28756777    23622113    19121390    26354079    30249741    21719571    + More
20798317    23691247    21282665    25401762    26823975    20566863    28797301    26830274    28049606    9215903    28528879    17615350    23056606    25243066    23236062    10452952    20360741    30723633    29451363    23594743    17975172    8798640    14561760    22398555    22722832    25362486    16136131    11181995    9570951    9533031    9781033    9712853    15489334    10518933    9990021    21269460    24166846    11980706    22002721    23559067    23698361    22118469    22002653    17431167    25319552    23127152    18563158    21881562    23254933    17554307   

EMBL

NWSH01001942    PCG69619.1    KZ149983    PZC75762.1    ODYU01002500    SOQ40063.1    + More
GAIX01006116    JAA86444.1    BABH01001171    KQ459700    KPJ20409.1    KY609772    ASO76487.1    KQ435711    KOX79598.1    QOIP01000005    RLU22936.1    KQ459606    KPI91177.1    GL888680    EGI58476.1    KQ434796    KZC05848.1    GL440607    EFN65728.1    GL452320    EFN77486.1    AK417573    BAN20788.1    LN830654    CFW94163.1    GEDC01021564    GEDC01004327    JAS15734.1    JAS32971.1    GL762354    EFZ21653.1    KK118801    KFM73881.1    GBHO01028419    GBHO01003972    GDHC01003710    JAG15185.1    JAG39632.1    JAQ14919.1    GECL01000028    JAP06096.1    ACPB03011807    GADI01008197    JAA65611.1    DS235751    EEB16347.1    GFPF01011306    MAA22452.1    GEDV01008988    JAP79569.1    GEFH01001033    JAP67548.1    LSMT01000119    PFX26731.1    GEFM01002881    JAP72915.1    GFTR01002644    JAW13782.1    AFYH01083657    AFYH01083658    AFYH01083659    HP429354    ADN29854.1    GFWV01020000    MAA44728.1    GFJQ02006083    JAW00887.1    DS469645    EDO37484.1    JX053274    AFK11502.1    JARO02005050    KPP67434.1    GAMT01008318    GAMS01002761    GAMR01008873    GAMQ01006195    GAMP01000690    JAB03543.1    JAB20375.1    JAB25059.1    JAB35656.1    JAB52065.1    JP015145    AES03743.1    AEYP01081359    AEYP01081360    AEYP01081361    AEYP01081362    AEYP01081363    AEYP01081364    AF113996    AF109151    AY029186    AJ427395    AJ427396    ABQF01023427    ABQF01023428    ABQF01023429    AHAT01022428    AHAT01022429    AEMK02000101    DQIR01223868    HDB79345.1    BC076096    AAH76096.1    CU459069    AGTP01044234    AGTP01044235    AGTP01044236    AGTP01044237    GABZ01008361    JAA45164.1    AANG04002752    U65073    CABD030019118    CABD030019119    CABD030019120    CABD030019121    CABD030019122    AJFE02075470    AJFE02075471    ABGA01277448    ABGA01277449    ABGA01277450    ABGA01277451    ABGA01277452    NDHI03003487    PNJ35200.1    AACZ04056637    AACZ04056638    GABC01010029    GABF01004999    GABD01005728    GABE01003100    NBAG03000230    JAA01309.1    JAA17146.1    JAA27372.1    JAA41639.1    PNI70378.1    AC073476    CR456980    CH471063    AAY24151.1    CAG33261.1    EAW70978.1    AF045999    AF022912    AF042835    AF042833    AF042834    AJ001626    BT007278    BC007831    AGBW02011630    OWR46396.1    GEBF01005494    JAN98138.1    GBBM01004056    JAC31362.1    GEBQ01023688    JAT16289.1    GECZ01012005    JAS57764.1    MUZQ01000110    OWK58019.1    QRBI01000134    RMC02049.1    LSYS01002834    OPJ85567.1    AGTO01020409    CM001287    EHH55245.1    JSUE03009833    JSUE03009834    JSUE03009835    JU334901    JU472104    JV045081    CM001264    AFE78654.1    AFH28908.1    AFI35152.1    EHH21758.1    JT406210    AHH37501.1    GG666738    EEN42257.1    AAWZ02024090    KB202283    ESO91294.1   

Proteomes

UP000218220    UP000005204    UP000053240    UP000053105    UP000279307    UP000053268    + More
UP000007755    UP000076502    UP000000311    UP000008237    UP000005203    UP000054359    UP000015103    UP000009046    UP000225706    UP000008672    UP000001593    UP000189705    UP000034805    UP000192224    UP000000715    UP000002254    UP000007754    UP000018468    UP000264820    UP000008227    UP000261560    UP000000437    UP000005215    UP000286641    UP000248481    UP000245341    UP000011712    UP000248482    UP000245340    UP000286642    UP000009136    UP000001519    UP000240080    UP000233020    UP000233200    UP000233040    UP000233220    UP000001595    UP000002277    UP000005640    UP000252040    UP000245320    UP000265300    UP000248484    UP000248483    UP000261681    UP000007151    UP000248480    UP000189706    UP000197619    UP000269221    UP000190648    UP000016665    UP000233120    UP000009130    UP000233140    UP000006718    UP000221080    UP000001554    UP000265020    UP000189704    UP000001646    UP000030746    UP000001038    UP000265180    UP000265200   

PRIDE

O43924   

Pfam

PF05351   GMP_PDE_delta

Interpro

IPR008015   PDED_dom        + More
IPR014756   Ig_E-set       
IPR037036   PDED_dom_sf       
IPR017287   Rhodop-sen_GMP-Pdiesterase_dsu       

SUPFAM

SSF81296   SSF81296       

Gene 3D

2.70.50.40    

ProteinModelPortal

A0A2A4JCP5   A0A2W1BL10   A0A2H1VGT6   S4P836   H9IUE9   A0A194RSP0   + More
A0A222AJF3   A0A0N0BJV9   A0A3L8DRK9   A0A194PD65   F4X519   A0A154P3N7   E2ALH0   E2C3E8   A0A088AMF8   R4WDD2   A0A0F7VHB0   A0A1B6E4X0   E9ICR9   A0A087U942   A0A0A9Z326   A0A0V0GDB8   T1HZU2   A0A0K8R3M0   E0VSJ1   A0A224Z7U2   A0A131YJV4   A0A131XN42   A0A2B4SA18   A0A131Y355   A0A224XYW4   H3AW39   E2J7D6   A0A293MXS2   A0A1Z5L0H9   A7SFK7   A0A1U7RQZ7   K4FYN5   A0A0P7UZU8   U3F978   G9KFR8   A0A1W5ALY7   M3Y0G7   Q9XT54   H0ZHQ2   W5LZK1   A0A3Q2XNJ1   F1SMV2   Q6DH83   A0A3B3D8M1   F1QZ52   I3M7F1   K9IYB0   A0A3Q7QTA1   A0A2Y9H2Z7   A0A2U3XS88   A0A2I2V1R8   A0A2Y9IWV0   A0A2U3VM51   A0A3Q7UGI7   Q95142   G3RCF1   A0A2R9ACJ4   A0A2K5C118   A0A2K6NXU1   A0A2K5R3A5   A0A2K6TJP9   H2P8W8   H2QJL5   Q6IB24   O43924   A0A341B407   A0A2U3UYK7   A0A340XTZ8   A0A2Y9FJH4   A0A2Y9MN01   A0A384ABW9   A0A212EY25   A0A0P6J443   A0A023GBU3   A0A2Y9E9N8   A0A1B6KXW7   A0A1U7QZ77   A0A1B6G5Q2   A0A218UWD8   A0A3M0JMF3   A0A1V4KP47   U3JYV3   A0A2K6BU11   G7PKA4   A0A2K5YLR0   F7BMR1   W5U688   C3ZYY6   A0A3Q2CXT1   A0A1U7UZ61   H9GII4   V4BQV6   A0A3B3HQE9   A0A3P9ITK7  

PDB

5T4X     E-value=4.10108e-65,     Score=624

KEGG

101742215    K13758 retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta | (RefSeq)

PATHWAY

00230    Purine metabolism - Bombyx mori (domestic silkworm)
01100    Metabolic pathways - Bombyx mori (domestic silkworm)

GO

GO:0004114   GO:0005737   GO:0050953   GO:0005634   GO:0005829   GO:0030659   GO:0001654   GO:0001822   GO:0005856   GO:0050896   GO:0007601   GO:0017137   GO:0005095   GO:0031410   GO:0042995   GO:0042622   GO:0005929   GO:0005488   GO:0006508   GO:0016301   GO:0016573   GO:0008270   GO:0022891   GO:0003707   GO:0051537  

PANTHER

PTHR12976  

Subcellular location

Nucleus  
Cytoplasm  
Cytosol  
Cytoplasmic vesicle membrane  
Cytoskeleton  
Cilium basal body  

Length:

157

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.00544

Exp number, first 60 AAs:

0.00015

Total prob of N-in:

0.32638

outside

1  -  157

 

 

Pi

326.721839

Theta

218.182719

Tajima's D

1.583725

CLR

0.321505

CSRT

0.8029598520074

Interpretation

Uncertain