SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07524
Pre Gene Modal
BGIBMGA003203
Annotation
PREDICTED:_uncharacterized_protein_LOC105842320_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.751
 

Sequence

CDS
ATGGCAAGACGACGATCAAAAAGCCAGTCCTTCGATGACGACGACAGTATTTTCGATCGACCAACGCGTGGTGGAATGTTTCACTTAACGGAGAATATCATCAGGAAGTTTGACGGCAAAGACAAAACTTATGCTGTAACAAAGTGGATACAAGATATAGAGGAAAATGGTGACATATTCGAGTGGACACCAAAGCAACGGTTATTAGTGGCTCGACGGTCATTAACCGGCACGGCAGCTTTGTGGTTAAATTCTGAAAAAACGTTTCCATGCTGGGATACTTTAAAGATAGCCATCAGTAAGGAGTTCCCTGACACCATAGACGCCAAGACTATTCACGAAATGATGAGTGCTAAAAAGAAAAAGTCAAATGAATCATGCATTGACTACATGTTTGCCATGAAAGAGCTTGGACGCCGAGGCAAAATGGCGGACTACGTGGCTATAAAATATGTTGTAGATGGCATACAAGATCAAGAAATAAATAAAATAATGCTATATGGAGTCACAACGTACGCTGAATTAAAGGAGAAATTAAAAATATACGAGATTTTGAAAGAAAAAATGAAGAGGAAAGAAGATATTCAATTACTGGACCTTTTGATGGAAGAAGAAAGACACAATTTCATTGACAGTAGAGAAGAACTTAGGAAGGAAGCGAAGAAACAAATATTTAAAGTCCAAGAAGAAAATAGAAGAAATTACAACAAGAAAATGAAAGAATGTACTATATACAAGGAAGGCGACTTAGTAGCTGTGAAAAGGACTCAGTTTGGTACAGGAATGAAACTGAAACCAAAGTTTTTGGGACCATATCGAATAGTAAAGGTCAAAAGAAAGAATAGATACAATGTTGAGAAGGCTGACGCACAAGTTGAAGGCCCTAACAAGACTACTACATCTGCTGATTTTATGAAAAAGTGGCCTGATTACTTAAGTGACTGA
Protein
MARRRSKSQSFDDDDSIFDRPTRGGMFHLTENIIRKFDGKDKTYAVTKWIQDIEENGDIFEWTPKQRLLVARRSLTGTAALWLNSEKTFPCWDTLKIAISKEFPDTIDAKTIHEMMSAKKKKSNESCIDYMFAMKELGRRGKMADYVAIKYVVDGIQDQEINKIMLYGVTTYAELKEKLKIYEILKEKMKRKEDIQLLDLLMEEERHNFIDSREELRKEAKKQIFKVQEENRRNYNKKMKECTIYKEGDLVAVKRTQFGTGMKLKPKFLGPYRIVKVKRKNRYNVEKADAQVEGPNKTTTSADFMKKWPDYLSD

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
314
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0032
Exp number, first 60 AAs:
0
Total prob of N-in:
0.17421
outside
1  -  314
 
 

Population Genetic Test Statistics

Pi
15.317694
Theta
24.026749
Tajima's D
-1.264448
CLR
8.131537
CSRT
0.095895205239738
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号