SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07426
Annotation
PREDICTED:_uncharacterized_protein_LOC105842156_[Bombyx_mori]
Full name
Putative uncharacterized transposon-derived protein F52C9.6      
Location in the cell
Nuclear   Reliability : 0.932
 

Sequence

CDS
ATGATTGCAAACTTGCGATATGCGAATGATACCACTTCATTTGCAACCAATGCGCAATCTTTGGAGAGGCTATTATTTAGGATGGTACGTATGTGTCTTGAGTTTGGATTGACGATTAATTGCAGTAAGACCAAAGTGATGATTATCGATCGCGCTAAGAATAACTCTTCGGACATGACTCAAATTGCGGGCTGTGACGTGGTCCAATCTTACATAATATAA
Protein
MIANLRYANDTTSFATNAQSLERLLFRMVRMCLEFGLTINCSKTKVMIIDRAKNNSSDMTQIAGCDVVQSYII

Summary

Keywords
Complete proteome   Reference proteome  
Feature
chain  Putative uncharacterized transposon-derived protein F52C9.6
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF00058   Ldl_recept_b
PF01457   Peptidase_M8
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR000033   LDLR_classB_rpt       
IPR011042   6-blade_b-propeller_TolB-like       
IPR001577   Peptidase_M8       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
73
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.04296
Exp number, first 60 AAs:
0.04296
Total prob of N-in:
0.52713
inside
1  -  73
 
 

Population Genetic Test Statistics

Pi
13.51575
Theta
14.137531
Tajima's D
-0.039681
CLR
0
CSRT
0.36233188340583
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号