SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO07364
Pre Gene Modal
BGIBMGA013783
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.064 Mitochondrial   Reliability : 1.428 Nuclear   Reliability : 1.691
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGCCAGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTTAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGCGCGAATTCAAAGAAATCCCAAACATGAAAAATTTTTTACCGTAGAAGAGAGCTACAACAAACAAAATGATAAGGTGTACGCACACAGTAGTGAAGAAGCGAGCAACCGTATTCCGCGTGTCCAACGAGGTCATTTTCCATCCTCGCTCATGGTATGGTTGGGAGTTTCTTATTGGGGCTTAACAGAGGTACATTTTTGTGAGAAAGGTGTAAAAACGAATGTAGTTGTGTATCAAAATACAGTCCTGACGAACCTTGTGGAACCTGTTTCTCATATCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGGCACGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCAAGTCCAGATTTGAATCCGTTAGATTACAAGATAAGGCAACACTTGGAGGAAAAGGCGTGCTTAAAGCCTCATGCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGATCATTTTGAATAA
Protein
MEWTLKEASVAVIALHRCGYAPIQIFNILKNFNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTPAVIKAVKARIQRNPKHEKFFTVEESYNKQNDKVYAHSSEEASNRIPRVQRGHFPSSLMVWLGVSYWGLTEVHFCEKGVKTNVVVYQNTVLTNLVEPVSHIMFNNRHWVFQQDSAPAHRAKSTQDWLAAREIDFIRHEDWPSSSPDLNPLDYKIRQHLEEKACLKPHANLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGDHFE

Summary

Similarity
Belongs to the TGF-beta family.
EMBL
RSAL01000012    RVE53510.1    AF461149    AAN06610.1    AB363006    AB363010    + More
AB363014    BAG15923.1    BAG15924.1    AB363028    BAG15927.1    AB473770    BAH20555.1    AB363018    BAG15926.1    RSAL01000063    RVE49524.1    RSAL01000021    RVE52408.1    RSAL01000022    RVE52367.1    U47917    AAB47739.1    RSAL01000470    RVE41612.1    LNIX01000030    OXA41211.1    RSAL01000133    RVE46339.1    JARK01001411    EYC06502.1    DS268606    EFO93488.1    DS268539    EFO88027.1    JOJR01000583    RCN36166.1    DS268747    EFP00909.1    PDUG01000012    PIC13506.1    UYSL01019905    VDL71189.1    KN728607    KIH63514.1    JARK01001337    EYC34439.1    DS268420    EFO87874.1    DS268565    EFO90304.1    DS268492    EFP11674.1    JOJR01000015    RCN51257.1    PDUG01000005    PIC23776.1    DS268428    EFO94379.1    EFP11689.1    DS268508    EFO83264.1    DS268466    EFP06959.1    CAVP010059404    CDL95787.1    HE601413    CAS00486.1    UZAH01001595    VDO19836.1    DS268525    EFO85497.1    DS268679    EFO98285.1    DS268612    EFO94085.1    DS268421    EFO88618.1    DS268673    EFO98001.1    JARK01001601    EYB87313.1    JARK01001418    EYC05389.1    JARK01001345    EYC27589.1    PIC28734.1    DS268545    EFO88382.1    PDUG01000006    PIC20538.1    JARK01000176    EYC41234.1    PIC29926.1    JARK01001658    EYB84158.1    PDUG01000001    PIC51673.1    JARK01000255    EYC39473.1    JARK01000059    EYC44525.1    UYSL01019770    VDL69590.1    PDUG01000004    PIC32571.1    UYSL01020440    VDL74616.1    LFYR01002220    KMZ56176.1    KA646003    AFP60632.1    KX931010    APL98300.1   
Pfam
PF00019   TGF_beta        + More
PF13358   DDE_3
PF00292   PAX
PF10320   7TM_GPCR_Srsx
Interpro
IPR001839   TGF-b_C        + More
IPR029034   Cystine-knot_cytokine       
IPR017948   TGFb_CS       
IPR015615   TGF-beta-rel       
IPR009057   Homeobox-like_sf       
IPR038717   Tc1-like_DDE_dom       
IPR001523   Paired_dom       
IPR036388   WH-like_DNA-bd_sf       
IPR036906   ATPase_V1_fsu_sf       
IPR017452   GPCR_Rhodpsn_7TM       
IPR000276   GPCR_Rhodpsn       
IPR019424   7TM_GPCR_Srsx       
SUPFAM
SSF57501   SSF57501        + More
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=2.96426e-08,     Score=137

Ontologies

Topology

Subcellular location
Secreted  
Length:
278
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.72638
Exp number, first 60 AAs:
1.4918
Total prob of N-in:
0.05756
outside
1  -  278
 
 

Population Genetic Test Statistics

Pi
1.398065
Theta
3.109399
Tajima's D
-1.486447
CLR
22.009448
CSRT
0.0534473276336183
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号