Gene

KWMTBOMO07340  Validated by peptides from experiments

Pre Gene Modal

BGIBMGA010673

Annotation

PREDICTED:_putative_ATP-dependent_RNA_helicase_me31b_[Bombyx_mori]

Location

Bomo_Chr12(+):10825948-10829366      View in EpiBrowser

Full name

ATP-dependent RNA helicase me31b      

Alternative Name

Maternal expression at 31B

Location in the cell

Cytoplasmic   Reliability : 1.81 Nuclear   Reliability : 2.374

CDS

ATGATGACCGAAAATAGAATTAGTTCAAGTAATCACGTCGGAAATAGTATCAGTCAAACTAAAGGAGAGGTCGACAAAAGCATCGACGACGTTGGTTGGAAATCAAAATTAAAAATACCCCCAAAAGACAGAAGAATAAAGACTAGTGATGTCACAGATACTAGAGGCAATGAGTTTGAAGAGTTTTGTTTGAAGCGAGAATTGTTGATGGGTATTTTTGAAAAGGGATGGGAGAAGCCATCTCCTATTCAAGAGGCCTCAATTCCTATTGCCCTAAGTGGAAAAGATGTACTTGCAAGAGCTAAGAATGGAACTGGTAAAACTGGTGCTTATTGTATTCCAGTTTTGGAACAGGTTGATCCTAAAAAGGATACTATACAAGCTTTAATTGTTGTACCAACTAGAGAGTTGGCACTCCAAACATCACAGATTTGTATTGAACTGGCAAAACACACAGACATTCGTGTAATGGTTACTACAGGAGGCACAAACCTTCGAGATGATATAATGCGTATTTATCAAAATGTACAAGTGATTATTGCCACACCTGGGCGTATGATTGATCTCATGGATAAGCAGGTGGCCAAAATGGATCAATGCCGGATGTTAGTTCTTGATGAAGCAGACAAACTTCTTTCACAAGACTTTAAGGGCATGCTGGATATGGTTATTTCAAGATTACCTAAGGAACGCCAAATCTTGCTGTTTTCTGCAACTTTCCCTCTGAGTGTAAAACAATTTATGGAAAAGCATTTGAAAGAACCTTATGAAATAAATCTCATGGAAGAATTAACATTGAAGGGTGTAACACAGTACTATGCATTTGTTCAAGAAAGACAAAAAGTGCATTGCCTTAACACACTTTTTTCAAAGTTGCAAATAAATCAGTCAATAATATTTTGTAATTCAACTCAAAGGGTGGAGTTGTTAGCCAAGAAGATAACAGAGTTAGGATATTGTTGCTACTACATCCACGCACGAATGGCACAAGCTCATCGTAATCGTGTGTTTCACGACTTTCGTGCTGGGCTCTGCCGTAACTTAGTGTGTTCAGACTTGTTCACTAGAGGTATTGATGTGCAAGCAGTTAATGTCGTTATCAATTTTGATTTTCCTCGAATGGCAGAGACATATCTTCATCGCATAGGACGCTCTGGACGTTTTGGGCACCTTGGTATTGCTATAAACTTAATCACATATGATGATCGTTTTGCACTACATCGTATCGAACAAGAACTGGGTACTGAAATCAAGCCAATTCCCAAAGTGATAGATCCTGCGCTATATGTAGCGCGTCCGGAAGATGAAGATCTGGGCGACAAGTAA

Protein

MMTENRISSSNHVGNSISQTKGEVDKSIDDVGWKSKLKIPPKDRRIKTSDVTDTRGNEFEEFCLKRELLMGIFEKGWEKPSPIQEASIPIALSGKDVLARAKNGTGKTGAYCIPVLEQVDPKKDTIQALIVVPTRELALQTSQICIELAKHTDIRVMVTTGGTNLRDDIMRIYQNVQVIIATPGRMIDLMDKQVAKMDQCRMLVLDEADKLLSQDFKGMLDMVISRLPKERQILLFSATFPLSVKQFMEKHLKEPYEINLMEELTLKGVTQYYAFVQERQKVHCLNTLFSKLQINQSIIFCNSTQRVELLAKKITELGYCCYYIHARMAQAHRNRVFHDFRAGLCRNLVCSDLFTRGIDVQAVNVVINFDFPRMAETYLHRIGRSGRFGHLGIAINLITYDDRFALHRIEQELGTEIKPIPKVIDPALYVARPEDEDLGDK

Description

ATP-dependent RNA helicase which is a core component of a variety of ribonucleoprotein complexes (RNPs) that play critical roles in translational repression and mRNA decapping during embryogenesis, oogenesis, neurogenesis and neurotransmission (PubMed:11546740, PubMed:16256742, PubMed:17178403, PubMed:18590813, PubMed:21267420, PubMed:21447556, PubMed:28875934, PubMed:28388438, PubMed:17982591). Recruits core components and translational repressors to some RNP complexes, and mediates RNP aggregation into processing granules such as P-bodies (PubMed:28875934, PubMed:11546740, PubMed:16256742, PubMed:17178403, PubMed:21267420, PubMed:21447556, PubMed:17982591). As part of a RNP complex containing tral, eIF4E1, cup, and pAbp, involved in RNP-mediated translational repression of maternal mRNAs during oogenesis and embryogenesis (PubMed:28875934). As part of a RNP complex containing tral and the RNA localization factors exu and yps, mediates translational silencing of mRNAs such as osk/oskar and bcd/bicoid during their transport to the oocyte in order to prevent their translation until they reach their positional destinations (PubMed:11546740). In neurons and possibly imaginal disks, involved in miRNA-mediated translational repression, possibly in association with components of the piRNA transposon silencing pathway (PubMed:21447556, PubMed:17178403, PubMed:21267420, PubMed:17982591, PubMed:21081899). Involved in RNA localization and protein trafficking in the oocyte (PubMed:11546740, PubMed:16256742). As part of an ER-associated RNP containing tral, cup and yps, required for tral-dependent ER exit site formation and consequently efficient trafficking of proteins such as grk and yl through the secretory pathway (PubMed:16256742). Component of neuron RNPs that mediate transport and translation of neuronal RNAs, including translation repression of synaptic transcripts in preparation for their dendritic targeting (PubMed:17178403, PubMed:21267420, PubMed:28388438). As part of the Atx2-Not1 repressor complex promotes Not1-dependent post-transcriptional gene silencing in adult circadian pacemaker neurons in order to sustain high-amplitude circadian rhythms and Pdf cycling in a per-independent manner (PubMed:28388438). Promotes the interaction between Atx2 and Not1 within the Atx2-Not1 RNP complex (PubMed:28388438).

Catalytic Activity

ATP + H2O = ADP + H(+) + phosphate

Subunit

Conserved component of different types of multiprotein ribonucleoprotein complexes (RNPs) that form distinct germ granules (P-body, nuage, sponge body or polar granules) and P-body-like neuronal RNPs (PubMed:11546740, PubMed:16256742, PubMed:18765641, PubMed:18590813, PubMed:19285948, PubMed:28388438). Consequently it interacts with a wide variety of proteins, some of which appear to be common interactive partners in almost all RNPs types i.e. cup and tral, whereas other interactions are specific to a germ granule/RNP (PubMed:28945271). Core functional components in me31B-containing RNPs include RNA regulatory proteins (such as translational repressor, RNA-decapping and exonuclease proteins), RNA localization proteins and additional proteins depending on the biological context of the RNPs (PubMed:17178403, PubMed:28945271). In the P-body RNPs, interacts with at least the translation repressor proteins tral, cup and Edc3, and the mRNA localization factor yps (PubMed:16256742, PubMed:18765641, PubMed:18590813, PubMed:19285948). Interaction with tral or Edc3 is required for translation repression and possibly RNA decapping; binding to tral and Edc3 is mutually exclusive (PubMed:18765641, PubMed:19285948). In the nuage and germ plasm polar granule RNPs, interacts with at least tral, cup, and additional proteins required for assembly and function of the germ granules such as tud, vas and aub (PubMed:18765641, PubMed:18590813, PubMed:19285948, PubMed:28945271). Interacts (when dimethylated on Arg residues) with tud; interaction is RNA-independent (PubMed:28945271). Component of the osk RNP complex, which is composed of at least me31B, exu, yps, aret/bruno, cup, and the mRNA of osk (PubMed:10662770). Component of the nos RNP complex, which is composed of at least smg, cup, tral, me31B, the CCR4-NOT complex members Rga/NOT2 and Caf1, and the mRNA of nos (PubMed:21081899). Interacts with tral and piRNA pathway components papi and AGO3; promotes interaction between nuage RNPs and the piRNA-mediated transposon silencing (PubMed:21447556). Forms a RNP containing at least me31B, eIF4E1, cup, tral and pAbp; this interaction is required for the translational silencing of maternal mRNAs during the maternal-to-zygotic transition (PubMed:28875934). In the sponge body, forms a RNP containing at least me31B, exu, yps and the mRNA of osk; interactions with exu and yps are RNA dependent (PubMed:11546740). Component of a neuronal RNP, at least composed of me31B, tral and Fmr1 (PubMed:17178403). Component of the Atx2-Not1 repressor complex, composed of at least me31B, Atx2, tyf and pAbp (PubMed:28388438). Interacts (via the C-terminus) with Atx2, tyf, pAbp and Lsm12 (PubMed:28388438).

Similarity

Belongs to the DEAD box helicase family.
Belongs to the DEAD box helicase family. DDX6/DHH1 subfamily.

Keywords

Alternative splicing   ATP-binding   Cell projection   Complete proteome   Cytoplasm   Endoplasmic reticulum   Helicase   Hydrolase   Methylation   Nucleotide-binding   Phosphoprotein   Reference proteome   Repressor   RNA-binding   Translation regulation  

Feature

chain  ATP-dependent RNA helicase me31b
splice variant  In isoform B.

Uniprot

A0A2A4IZG5   A0A2H1W8U6   A0A3S2LFJ2   A0A212EQ68   A0A194R3F2   A0A194PHZ1   + More
S4P9P6   A0A0L7L2C1   A0A2J7PK95   A0A2A3EJ00   V9IH05   A0A087ZPS2   A0A3L8E4W4   A0A154NY43   A0A195ECR5   F4WYD1   A0A195B0L1   A0A195EUR5   A0A158NXN5   A0A151WPT3   A0A151INQ9   K7IWA6   A0A411G6B8   A0A232F259   E2BHT6   E2AXW4   A0A1Y1LM34   A0A026WKK7   A0A0C9R3F6   A0A0T6B766   A0A310SEQ8   A0A0M9A4X6   V5I8P5   A0A0J7KTU2   D2A381   A0A1W4WNE5   A0A2M3Z110   A0A2M4A6Y0   W5JQL4   Q16YL3   A0A182F5D4   A0A182YFB3   A0A1S4H099   A0A182V9Z3   A0A182KAC8   A0A182TSY4   A0A182WYP5   A0A182I526   A0A182NZW5   A0A023ES83   A0A182NF06   A0A182QAX6   A0A1Q3G059   A0A182WH29   A0A084WBY7   A0A182IK09   A0A182R9K9   A0A1L8DS42   A0A182LU81   T1DI54   T1DE88   A0A336KSZ1   A0A2S2QGI1   A0A2H8TP48   Q7PVZ9   A0A336MAM1   X1WJ96   A0A182KUL6   E0VNV1   U5EIR7   A0A0K8VY29   A0A034WY57   A0A0A1WZ36   W8CEF8   H9JMC0   A0A1J1HG36   A0A0L0CF16   B4G7J5   A0A1L8EDM6   N6TLE2   A0A1A9Y6X8   A0A3B0JGW0   A0A1A9UT91   B3MPN5   A0A1A9ZVN5   D3TMT9   A0A1W4UUQ0   B4NZ69   A0A1I8P2L6   B4HWI1   B3N945   B4Q8R4   P23128   T1HZ66   B4LR21   B4KJI4   A0A0P6G5J9   A0A0P4VPZ6   A0A1B0BD30   A0A1A9WLA9  

EC Number

3.6.4.13

Pubmed

22118469    26354079    23622113    26227816    30249741    21719571    + More
21347285    20075255    28648823    20798317    28004739    24508170    18362917    19820115    20920257    23761445    17510324    25244985    12364791    24945155    26483478    24438588    24330624    20966253    20566863    25348373    25830018    24495485    19121390    26108605    17994087    23537049    20353571    17550304    22936249    1900936    10731132    12537572    12537569    10662770    11546740    16256742    17178403    17982591    18327897    18765641    18590813    19285948    21267420    21447556    21081899    28875934    28945271    28388438    27129103   

EMBL

NWSH01004597    PCG64876.1    ODYU01007045    SOQ49467.1    RSAL01000020    RVE52672.1    + More
AGBW02013325    OWR43601.1    KQ460845    KPJ12054.1    KQ459603    KPI92668.1    GAIX01003669    JAA88891.1    JTDY01003429    KOB69570.1    NEVH01024940    PNF16761.1    KZ288227    PBC31773.1    JR045312    AEY59952.1    QOIP01000001    RLU27435.1    KQ434782    KZC04589.1    KQ979074    KYN23003.1    GL888440    EGI60783.1    KQ976692    KYM77739.1    KQ981958    KYN31988.1    ADTU01003248    KQ982851    KYQ49876.1    KQ976914    KYN07110.1    MH365626    QBB01435.1    NNAY01001168    OXU24906.1    GL448324    EFN84769.1    GL443736    EFN61728.1    GEZM01051800    GEZM01051799    JAV74693.1    KK107168    EZA56181.1    GBYB01001340    GBYB01001341    JAG71107.1    JAG71108.1    LJIG01009384    KRT83187.1    KQ769958    OAD52719.1    KQ435746    KOX76536.1    GALX01004325    JAB64141.1    LBMM01003169    KMQ93867.1    KQ971338    EFA02274.2    GGFM01001452    MBW22203.1    GGFK01003223    MBW36544.1    ADMH02000797    ETN65039.1    CH477514    EAT39722.1    AAAB01008984    APCN01003750    JXUM01012051    GAPW01001488    KQ560344    JAC12110.1    KXJ82940.1    AXCN02000838    GFDL01001840    JAV33205.1    ATLV01022519    KE525333    KFB47731.1    AXCP01003185    GFDF01004863    JAV09221.1    AXCM01006387    GALA01001136    JAA93716.1    GALA01001137    JAA93715.1    UFQS01000880    UFQT01000880    SSX07467.1    SSX27807.1    GGMS01007644    MBY76847.1    GFXV01003886    MBW15691.1    EAA14695.3    UFQS01000798    UFQT01000798    SSX06981.1    SSX27325.1    ABLF02034022    ABLF02034026    ABLF02034027    DS235354    EEB15057.1    GANO01002524    JAB57347.1    GDHF01008583    JAI43731.1    GAKP01000264    JAC58688.1    GBXI01013005    GBXI01010366    JAD01287.1    JAD03926.1    GAMC01000271    JAC06285.1    BABH01033456    CVRI01000001    CRK86372.1    JRES01000469    KNC30993.1    CH479180    EDW28395.1    GFDG01001981    JAV16818.1    APGK01032042    KB740834    ENN78803.1    OUUW01000006    SPP81634.1    CH902620    EDV32283.1    CCAG010023389    EZ422741    ADD19017.1    CM000157    EDW88764.1    CH480818    EDW52376.1    CH954177    EDV58480.1    CM000361    CM002910    EDX04479.1    KMY89442.1    M59926    AE014134    AY051663    ACPB03008638    CH940649    EDW64560.1    CH933807    EDW13564.1    GDIQ01040699    JAN54038.1    GDKW01001518    JAI55077.1    JXJN01012268   

Proteomes

UP000218220    UP000283053    UP000007151    UP000053240    UP000053268    UP000037510    + More
UP000235965    UP000242457    UP000005203    UP000279307    UP000076502    UP000078492    UP000007755    UP000078540    UP000078541    UP000005205    UP000075809    UP000078542    UP000002358    UP000215335    UP000008237    UP000000311    UP000053097    UP000053105    UP000036403    UP000007266    UP000192223    UP000000673    UP000008820    UP000069272    UP000076408    UP000075903    UP000075881    UP000075902    UP000076407    UP000075840    UP000075885    UP000069940    UP000249989    UP000075884    UP000075886    UP000075920    UP000030765    UP000075880    UP000075900    UP000075883    UP000007062    UP000007819    UP000075882    UP000009046    UP000005204    UP000183832    UP000037069    UP000008744    UP000019118    UP000092443    UP000268350    UP000078200    UP000007801    UP000092445    UP000092444    UP000192221    UP000002282    UP000095300    UP000001292    UP000008711    UP000000304    UP000000803    UP000015103    UP000008792    UP000009192    UP000092460    UP000091820   

PRIDE

H9JMC0    P23128   

Pfam

PF00271   Helicase_C        + More
PF00270   DEAD

Interpro

IPR014014   RNA_helicase_DEAD_Q_motif        + More
IPR011545   DEAD/DEAH_box_helicase_dom       
IPR001650   Helicase_C       
IPR014001   Helicase_ATP-bd       
IPR000629   RNA-helicase_DEAD-box_CS       
IPR027417   P-loop_NTPase       

SUPFAM

SSF52540   SSF52540       

CDD

cd00079  HELICc

ProteinModelPortal

A0A2A4IZG5   A0A2H1W8U6   A0A3S2LFJ2   A0A212EQ68   A0A194R3F2   A0A194PHZ1   + More
S4P9P6   A0A0L7L2C1   A0A2J7PK95   A0A2A3EJ00   V9IH05   A0A087ZPS2   A0A3L8E4W4   A0A154NY43   A0A195ECR5   F4WYD1   A0A195B0L1   A0A195EUR5   A0A158NXN5   A0A151WPT3   A0A151INQ9   K7IWA6   A0A411G6B8   A0A232F259   E2BHT6   E2AXW4   A0A1Y1LM34   A0A026WKK7   A0A0C9R3F6   A0A0T6B766   A0A310SEQ8   A0A0M9A4X6   V5I8P5   A0A0J7KTU2   D2A381   A0A1W4WNE5   A0A2M3Z110   A0A2M4A6Y0   W5JQL4   Q16YL3   A0A182F5D4   A0A182YFB3   A0A1S4H099   A0A182V9Z3   A0A182KAC8   A0A182TSY4   A0A182WYP5   A0A182I526   A0A182NZW5   A0A023ES83   A0A182NF06   A0A182QAX6   A0A1Q3G059   A0A182WH29   A0A084WBY7   A0A182IK09   A0A182R9K9   A0A1L8DS42   A0A182LU81   T1DI54   T1DE88   A0A336KSZ1   A0A2S2QGI1   A0A2H8TP48   Q7PVZ9   A0A336MAM1   X1WJ96   A0A182KUL6   E0VNV1   U5EIR7   A0A0K8VY29   A0A034WY57   A0A0A1WZ36   W8CEF8   H9JMC0   A0A1J1HG36   A0A0L0CF16   B4G7J5   A0A1L8EDM6   N6TLE2   A0A1A9Y6X8   A0A3B0JGW0   A0A1A9UT91   B3MPN5   A0A1A9ZVN5   D3TMT9   A0A1W4UUQ0   B4NZ69   A0A1I8P2L6   B4HWI1   B3N945   B4Q8R4   P23128   T1HZ66   B4LR21   B4KJI4   A0A0P6G5J9   A0A0P4VPZ6   A0A1B0BD30   A0A1A9WLA9  

PDB

5ANR     E-value=7.52071e-176,     Score=1585

KEGG

101742881    K12614 ATP-dependent RNA helicase DDX6/DHH1 [EC:3.6.4.13] | (RefSeq) putative ATP-dependent RNA heli

GO

GO:0003676   GO:0004386   GO:0005524   GO:0003743   GO:0035195   GO:2000766   GO:0050688   GO:1990124   GO:0000932   GO:1905618   GO:0043186   GO:0070971   GO:0043025   GO:0098794   GO:1990120   GO:0071683   GO:0090328   GO:0071598   GO:0003723   GO:0030707   GO:0033962   GO:0150011   GO:0007279   GO:0046959   GO:0060148   GO:0005737   GO:0036464   GO:0005783   GO:0043565   GO:0005852   GO:0006446   GO:0043022   GO:0005488   GO:0003707   GO:0051537  

Subcellular location

Cytoplasm   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.
Cytoplasmic ribonucleoprotein granule   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.
P-body   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.
Endoplasmic reticulum   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.
Cell projection   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.
Dendrite   Component of a variety of germ granule ribonucleoprotein complexes (RNPs) including the nuage of nurse cells, sponge bodies of nurse cells and early egg chambers in oocytes, as well as polar granules in the germ plasm at the posterior pole of mid-late stage oocytes and in early embryos (PubMed:11546740, PubMed:18590813, PubMed:21447556, PubMed:28945271, PubMed:21267420). Component of an RNP that localizes to discrete subdomains of the ER cytoplasmic surface (PubMed:21267420, PubMed:16256742). Also present in cytoplasmic granules in the cell bodies and neuropil area of the antennal lobes (PubMed:21267420). In the olfactory sensory and projection neurons, granules appear to predominately localize to postsynaptic dendrites (PubMed:21267420).   With evidence from 5 publications.

Length:

441

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.01117

Exp number, first 60 AAs:

0

Total prob of N-in:

0.00975

outside

1  -  441

 

 

Pi

2.177638

Theta

5.778261

Tajima's D

-1.468216

CLR

0.887207

CSRT

0.0582470876456177

Interpretation

Uncertain